专利摘要:
les maladies causées par des protozoaires parasites, _________________________________________________________________________________________________„ ................................ comme un parasite Plasmodium ou les helminthes parasites. This invention relates to compositions (e.g., vaccine compositions) that can be used to provide a subject with protective immunity against parasite infection. The compositions comprise: (i) an immunologically effective amount of a nucleic acid (e.g., a nucleic acid vaccine) comprising a sequence that encodes an inhibitory factor antigen (MIF), a macrophage migration parasite; (ii) a parasite MIF antigen; or (iii) an antibody that specifically binds to a parasite MIF antigen. The compositions can be used to treat infections and diseases caused by parasitic protozoa, _________________________________________________________________________________________________ "................................ as a Plasmodium parasite or parasitic helminths .
公开号:BE1022446A9
申请号:E20155182
申请日:2015-03-25
公开日:2016-10-06
发明作者:Richard Bucala;Andrew Geall
申请人:Univ Yale;Glaxosmithkline Biologicals Sa;
IPC主号:
专利说明:

USES OF INHIBITION FACTORS OF MIGRATION OF
MACROPHAGES PARASITES
This application claims the benefit of European Patent Application 14161614.4 (filed March 25, 2014), the entire contents of which are incorporated herein by reference for all purposes.
TECHNICAL AREA
This invention relates to the field of treatment and prevention of parasitic infections. In particular, the present invention relates to the use of parasite macrophage migration inhibition (MIF) factors for the prevention of parasitic infections such as malaria.
BACKGROUND OF THE TECHNIQUE
Parasitic diseases caused by protozoa and helminths affect billions of people around the world and cause millions of deaths each year, especially in tropical countries. Malaria, for example, which is caused by Plasmodium protozoan, infects 300 to 500 million people each year and causes more than one million deaths. More than a third of the world's population is at risk of malaria. The mortality related to the disease is mainly caused by complications due to severe anemia, shock and cerebral malaria, which may be associated with an excessive pro-inflammatory response. Malaria kills the immunologically naive population, for example, young children. Recurrent or persistent malaria infection can lead to "tolerance" of a serious disease, but memory CD4 T cells do not appear to be adequately maintained after malaria infection and protective and "sterilizing" immunity develops never. [1]. This inability to develop or maintain effective "sterilizing" immunity following infection has been recognized as a feature of many other parasitic infections in addition to malaria. [2]. This makes the development of vaccines particularly difficult.
The parasite Leishmania, a flagellated protozoan, is another major cause of parasitic disease. Leishmaniasis affects about 12 million people a year and causes about 60,000 deaths, and about 350 million people are considered at risk. Schistosomiasis is caused by parasitic helminths of the genus Schistosoma and is estimated to affect 200 million people worldwide and cause about 20,000 deaths. It is estimated that the hookworm infection of the nematodes Necator americanus and Ancylostoma duodenale affects more than 700 million people. Other parasitic diseases, such as toxoplasmosis, lymphatic filariasis, onchocerciasis and guinea worm, are thought to affect more than one billion people worldwide alone. However, researchers have struggled to develop vaccines against these parasites because of their complex multicellular life cycles, antigenic variability, and immune evasion. Thus, there is still a huge demand for effective treatments that protect against parasitic infections, such as malaria. DESCRIPTION OF THE INVENTION
The present inventors have unexpectedly found that the macrophage migration inhibition factor (MIF) from a parasite can be used as an effective antigen in a vaccine to provide protective immunity against parasite infection. .
In particular, the inventors concluded that the immunization of mice with a self-replicating RNA vaccine encoding Plasmodium berghei MIF ortholog (PbMIF) led to a measurable and significant decrease in parasitaemia following the initial Plasmodium challenge and a reduction pronounced parasitaemia after healing and resumption of the test. Reduced parasitaemia was accompanied by an expansion of the memory T cell population responding to Plasmodium in treated mice. The inventors have also shown that immunization with an adjuvant PbMIF antigen was well tolerated and induced a solid anti-PbMIF immune response. Immunization with PbMIF therefore allows for increased development of memory T cells and provides significant protection against re-infection of malaria. In addition, the inventors have shown that the passive transfer of an anti-PbMIF antibody significantly reduces parasitaemia following infection of P. berghei.
In mammals, MI F is an ubiquitous and highly conserved proinflammatory cytokine with enzymatic tautomerase and oxidoreductase activities and is involved in the regulation of a wide range of immune responses. The role of MIF in the mammalian immune system has been extensively studied and has been implicated in the pathogenesis of several diseases such as septic shock, asthma, rheumatoid arthritis and inflammatory bowel disease [3,4 ]. The precise molecular mechanisms by which MIF functions are not yet well understood, but the MIF mammal has been shown to be able to bind to and exert its inflammatory effects via the CD74 cell surface receptor (also known as the MIF-R MIF receptor) ) [5,6]. However, the role of MIF has been widely considered to be limited to the innate immune system.
MIF orthologues or homologues are found in many parasitic organisms that infect mammals, including unicellular protozoan parasites such as Plasmodium, Leishmania, and Toxoplasma, and helminths and parasitic nematodes such as Brugia and Ancyclostoma. Despite the fact that low levels of sequence identity are often shared, these parasite orthologs share close structural and functional similarities to the MIFs of their mammalian hosts [3, 4, 5]. Thus, the present invention is applicable to a wide range of parasites that express an orthologue or homologue of MIF. For example, a MIF ortholog produced by Leishmania major has been identified that shares significant structural and functional homology with human MIF, including tautomerase, chemotactic and anti-apoptotic activities and MIF-R binding [7] . The MIF proteins produced by Plasmodium falciparum and Plasmodium berghei have been shown to be similar to each other, to MIF mammals and other parasitic MIFs, to interact with MIF-R, and to share similar enzymatic and pro-inflammatory functions.
For the sake of their conservation and their structural distribution between distantly evolving species, the present inventors have hypothesized that MIF parasitic orthologs play a role in evading the host immune response. Sun et al. [5] have recently shown that Plasmodium MIF increases the production of inflammatory cytokines and induced activated CD4 T cells to transform them into short-acting effector cells rather than precursor memory cells in infected mice, preventing the establishment of immunological memory. In addition, CD4 T cells were more sensitive to apoptosis and CD4 T cell recall responses against induced infections were reduced. Speculative therapeutic applications targeting MIF have been proposed. For example, Dobson et al. [4] suggested that Plasmodium MIF could be a potential target for drugs and that it would be important to selectively target the MIF parasite against host proteins. Vermeire et al. [3] suggested that drugs or vaccines specifically targeting nematode MIF orthologs may have therapeutic value. Cho et al. [8] found that immunization of hamsters with an MIF ortholog of Ancylostoma verum has reduced the clinical symptoms of hookworm-associated disease (weight loss and anemia) and suggested targeting the MIF's hookylostome with inhibitors of small molecules to treat the infection. However, none of these documents elucidates a precise role for MIF orthologs in parasitic infections and, prior to the present invention, no specific therapeutic application of MIF invertebrate parasites had been provided.
In contrast, the inventors have identified for the first time that an immune response against MIF can be used to provide protective immunity against parasitic infection. In particular, the inventors have shown that parasitic MIFs are viable vaccine candidates that can be used either as stand-alone antigens or in combination with other parasite antigens in order to promote memory responses of long memory T cells. duration and protective immunity against parasite infection. The results of the inventors also show that a humoral immune response against parasitic MIF can effectively protect a subject against parasite infection. Protective immunity against parasite infection can therefore be established in a subject by eliciting an immune response against the parasitic MIF and / or by blocking the parasitic MIF function in the subject, thereby enabling a subject to develop immunological memory protective against the parasite, particularly when the subject is, or has been, exposed to parasitic antigens other than MIF (eg due to infection or exposure to other parasitic vaccines).
Accordingly, in one aspect, the invention provides a method for providing protective immunity against parasitic infection in a subject in need, comprising administering an immunologically effective amount of a composition to the subject, wherein the composition comprises (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. In some embodiments, the method may comprise administering a combination of (i), (ii) and / or (iii).
In another aspect, the invention provides a composition for use in a method for providing protective immunity against parasitic infection in a subject in need, which comprises an immunologically effective amount of: (i) a nucleic acid comprising a sequence which encodes a parasitic MIF antigen; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. The composition may be a pharmaceutical composition. Accordingly, the composition may also include a pharmaceutically acceptable carrier. In some embodiments, the composition of (i) or (ii) is a vaccine composition. The invention also provides a method for providing protective immunity against parasitic infection in a subject in need, comprising administering isolated parasite-sensitive CD4 T cells from a compatible host (preferably of the same species as the subject), wherein the host has been immunized with a composition of the invention: namely a composition which comprises an immunologically effective amount of (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen or (ii) a parasitic MIF antigen. The composition of the invention may have been administered to the compatible host in accordance with a method for providing protective immunity as described herein. The compatible host may be administered a composition of the invention in a single dose or multiple doses (i.e., two or more doses) as described above. In some embodiments, the compatible host may have been immunized with the composition and subsequently infected with the parasite (see below) or immunized with another parasitic antigen (to produce the parasite-sensitive CD4 T cell population ). In some embodiments, the compatible host may have been cured of the parasitic infection, for example by administering an agent that kills or attenuates the parasite. For example, Plasmodium infection can be cured by administering an antimalarial. Examples of such agents / antimalarials include chloroquine (CQ), doxycycline, atovaquone (plus proguanil) and mefloquine. In some embodiments, the parasite-sensitive CD4 T cells have been isolated from a compatible host that has been: (i) administered with a composition of the invention and (ii) subsequently infected with the parasite or immunized with another parasite antigen (to produce the parasite-sensitive CD4 T cell population). Optionally, (eg where the host is infected with the parasite), the host may also have been cured of the parasite infection prior to isolation of the parasite-sensitive CD4 T cells. The parasite-sensitive CD4 T cells isolated from said host may provide in the subject sterilizing immunity (i.e., total protective immunity), whereby the protected subject can elicit an immune response which completely eliminates the infection by the parasite.
The parasite may be an invertebrate parasite, for example protozoan or helminth. In some embodiments, the parasite is a protozoan, for example an apicomplex parasite such as Plasmodium. In some embodiments, the parasitic protozoan belongs to a genus selected from the group consisting of: Plasmodium, Toxoplasma, Babesia, Eimeria, Theileria, Neospora, Sarcocystis, Leishmania and Trypanosoma. In some embodiments, the parasite is a helminth, for example a nematode. In some embodiments, the parasitic helminth belongs to a genus selected from the group consisting of: Ancyclostoma, Necator, Brugia, Wuchereria, Loa, Mansonella, Trichinella, Trichuris, Ascaris,
Anisakis, Dracunculus, Strongyloides, Haemonchus, Schistosoma and Fasciola.
In another aspect, the invention relates to a composition comprising an immunologically effective amount of: (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; or (ii) a parasitic MIF antigen; wherein the MIF antigen is from a parasitic protozoan. The invention also provides a composition comprising an immunologically effective amount of: (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; or (ii) a parasitic MIF antigen; wherein the MIF antigen is a parasitic helminth that belongs to a genus selected from the group consisting of: Ancyclostom'a, Necator, Brugia, Wuchereria, Loa, Mansonella, Trichinella, Trichuris, Ascaris, Anisakis, Dracunculus, Strongyloides, Haemonchus ,
Schistosoma and Fasciola.
Parasitic MIF Antigens The use of a parasitic MIF antigen in the present invention generates an immune response in a subject having a naturally occurring parasite MIF polypeptide (eg, a protective immune response). The parasitic MIF antigen may also be referred to as a parasitic MIF polypeptide antigen. "Parasitic MIF antigen" includes immunogenic fragments of a parasitic MIF polypeptide, but also a whole or full length parasite MIF polypeptide. For example, a parasitic MIF antigen may comprise or consist of a full-length parasitic MIF polypeptide or an immunogenic fragment of a parasitic MIF polypeptide. The parasitic MIF polypeptide may be a naturally occurring parasite MIF polypeptide or a variant thereof (i.e., a variant having one or more amino acid and / or deletion substitutions). In some embodiments, the parasitic MIF antigen has a contiguous amino acid sequence and / or an epitope that is found in a naturally occurring parasite MIF polypeptide.
The "parasite MIF polypeptide of natural origin", as used hereinafter, refers to a MIF polypeptide that is expressed in nature by a parasite. Generally, a naturally occurring parasite MIF polypeptide is from about 110 to about 120 amino acids in length. In its mature, transformed form, it has an N-terminal proline residue (formed after methionine cleavage during initial protein treatment). A parasitic MIF polypeptide of natural origin may have at least one biological activity selected from MIF and -R (e.g. CD74 human) tautomerase enzymatic activity of a binding activity. Naturally occurring parasite MIF polypeptides are members of a unique structural superfamily, characterized by the formation of a trimer of identical subunits. In a naturally occurring MIF, each monomer may contain two antiparallel alpha-helices that race against a four-stranded beta sheet, with each monomer having two additional beta strands that interact with the beta sheets of adjacent subunits to form interface between the monomers. The three beta sheets can be arranged to form a barrel containing a solvent-accessible chain that passes through the center of the protein along a triple molecular axis.
Examples of naturally occurring MIF polypeptides include:
Plasmodium falciparum MIF (accession number UniProt Q8I5C5); IDENTIFIER SEQUENCE: 1:
PCCEVITNVNLPDDNVQSTLSQIENAISDVMGKPLGYIMSNYDYQKNLRFGGSNEAYC FVRITSIGGINRSNNSALADQITKLLVSNLNVKSRRIYVEFRDCSAQNFAFSGSLFG Plasmodium berghei MIF (UniProt accession number Q4YQW0); IDENTIFIER SEQUENCE: 2:
PCCELITNISIPDDKAQNTLSEIEDAISNILGKPVAYIMSNYDYQKNLRFSGSNEGYC FVRLTSIGGINRSNNSLLADKITKILSNHLSVKPRRVYIEFRDCSAQNFAFSGSLFG Plasmodium yoelii MIF (accession number UniProt Q1HEA2); IDENTIFIER SEQUENCE: 3: PCCELITNISIPDDKAQNALSEIEDAISNVLGKPVAYIMSNYDYQKNLRFSGSNEGYC FVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCSAQNFAFSGSLFG Plasmodium yoelii MIF (accession number UniProt Q4Y5M8); IDENTIFIER SEQUENCE: 4: PCCELITNISIPDDKAQAALSEIEDAISNVLGKPTAYIMSNYDYQKNLRFAGSNEGYC FVRLTSLGGINRSNNSSLADKITKHLANHLGVKPRRVYIEFRDCSAQNFAFSGSLFG Plasmodium vivax MIF (UniProt accession number A5K093); IDENTIFIANT SEQUENCE: 5: PCCQVSTNINASDDDAKKALSQIENAISQVLGKPLGYIMSNLDYQKHMRFGGSHDGFC FVRVTSLGGINKSNNSSLADKITKILASTLNVKSERVFIEFKDCSAQNFAFNGSLFG Plasmodium knowlesi MIF (UniProt accession number B3LCT3); IDENTIFIANT SEQUENCE: 6: PCCQVSTNINVSDDDAKKALMQIENAISQVMNKPMGYIMSNLDYQKHMRFGGSHDGFC FVRVTSISGISRSNNTALADKITKILASTIKVKSDRVFIEFKDCSAQNFAFNGSLFG Toxoplasma gondii MIF (accession number UniProt A1XDS9); SEQUENCE IDENTIFIER: 7: PKCMIFCPVAATPAQQDALLKDAEKAVADALGKPLSYVMVGYSQTGQMRFGGSSDPCA FIRVASIGGITSSTNCKIAAALSAACERHLGVPKNRIYTTFTNKSPSEWAMGDRTFG Leishmania major mifi ((UniProt accession number Q4Q413); SEQUENCE IDENTIFIER: 8: PVIQTFVSTPLDHHKRENLAQVYRAVTRDVLGKPEDLVMMTFHDSTPMHFFGSTDPVA CVRVEALGGYGPSEPEKVTSIVTAAITKECGIVADRIFVLYFSPLHCGWNGTNF Leishmania major MIF2 (UniProt accession number Q4Q412); SEQUENCE IDENTIFIER: 9: PFLQTIVSVSLDDQKRANLSAAYGMICREELGKPEDFVMTAFSDKTPISFQGSTAPAA YVRVESWGEYAPSKPKMMTPRIAAAITKECGIPAERIYVFYYSTKHCGWNGTNF Giardia intestinalis MIF ( UniProt accession number A8BFP4); IDENTIFIER SEQUENCE: 10: PCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCF VDFYCIGVISQAKNPSISAAITGCLTQHFKVKPERVYISFNEAKGHNWGFNGSTF Brugia malayi MIF (UniProt accession number A8PJU3); IDENTIFIER SEQUENCE: 11:
PYFTIDTNIPQNSISSAFLKKASNWAKALGKPESYVSIHVNGGQAMVFGGSEDPCAV
CVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIEFVDIEASSMAFNGSTFG
Wuchereria bancrofti MIF (UniProt accession number 044786); IDENTIFIER SEQUENCE: 12: PYFTIDTNKPQDSISSAFLKKAPNVVPKALGKPESYVSIHVNGGQPMVFGGSEDPCPV CVLKSIGCVGPKVNNSHAEKLYKLLADELKIPKNRCYIESVDIEASSMAFNGSTFG Ancylostoma duodenale MIF (accession numberProt I3RWR9); IDENTIFIER SEQUENCE: 13:
PMVRVATNLPDKDVPANFEERLTDILAESMNKPRNRIAIEVMAGQRITHGASRNPVAV
IKVESIGALSADDNIRHTQKITQFCQDTLKLPKDKVIITYFDLQPIHVGFNGTTVAAA
TM
Ancylostoma ceylanicum MIFi (UniProt accession number A4GRE3); IDENTIFIER SEQUENCE: 14:
PMVRVATNLPDKDVPANFEERLTDLLAESMNKPRNRIAIEVLAGQRITHGASRNPVAV
IKVESIGALSADDNIRHTQKITQFCQDTLKLPKDKVIITYFDLQPIHVGFNGTTVAAA
TM
Ancylostoma ceylanicum MIF2 (UniProt accession number B6RTC1); IDENTIFIER SEQUENCE: 15: PVFQLHTNVSQDKVTPDLLKQISALVARILHKPESYVAVHVVPDQKMTFAGTDGPCGI GILKSIGGVGGSQNNSHAKALFALIKDHLGIEGSRMYIEFVDIGASDIAHNGRTFA Trichinella spiralis MIF (UniProt accession number E5SFT7); IDENTIFIER SEQUENCE: 16: PIFTLNTNIKATDVPSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAF GTLMSIGGIEPSRNRDHSAKLFDHLNKKLGIPKNRMYIHFVNLNGDDVGWNGTTF Trichuris trichiura MIF (UniProt accession number P81748); IDENTIFIER SEQUENCE: 17: PIFTFSTNVPSENISVDFLKSTSKLIAGMLGKPESYVAVHINGGQKITFGGTDAPAGF GQLLSLGGVGGEKNRSHSAKLFKHLTDGLGIPGNRMYINFVDMRGSDVGYNGSTF Onchocerca volvulus MIF (UniProt accession number Q963F7); IDENTIFIER SEQUENCE: 18: PAFTINTNIPQSNVSDAFLKKASSTVAKALGKPESYVAIHVNGGAMVFGGSTDPCAV CVLKSIGCVGPNVNNSHSEKLFKLLADELKIPKNRCYIEFVNIDASTMAFNGSTFG The UniProt accession numbers mentioned above refer to MIF polypeptide sequences that include an N-terminal methionine that is not present in the mature MIF polypeptide. SEQUENCE IDENTIFIERS: 1-18 show the mature MIF polypeptide sequence, starting with an N-terminal proline.
A parasitic MIF antigen may include a parasitic MIF polypeptide which is a variant of a parasite MIF polypeptide of natural origin. The variant may comprise an amino acid sequence which is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% % identical to a parasite MIF polypeptide of natural origin of full length for example, a polypeptide according to IDENTIFIER SEQUENCE: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 , 14, 15, 16, 17 or 18. Alternatively, or in addition, the parasitic MIF antigen may comprise an immunogenic fragment (i.e., an epitope-containing fragment) of a parasitic MIF polypeptide which may contain an amino acid sequence of at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17 at least 18, at least 19 amino acids identical to a contiguous amino acid sequence of a naturally occurring parasite MIF polypeptide, for example, a polypeptide according to IDENTIFIER SEQUENCE: 1, 2, 3, 4, 5 , 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 or 18.
In some embodiments, the parasitic MIF antigen comprises an amino acid sequence that is at least 70% identical (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical) to IDENTIFIER SEQUENCE: 1 and / or comprises a sequence of contiguous amino acids of at least 8 amino acids (eg, at least 9, at least minus 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19 amino acids) which is identical to an acid sequence In certain embodiments, the parasitic MIF antigen comprises an amino acid sequence that is at least 70% identical (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical) to 1: 2 and / or includes a contiguous amino acid sequence of at least 8 amino acids born (eg at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19 amino acids ) which is identical to a contiguous amino acid sequence of the SEQUENCE IDENTIFIER: 2.
When the parasitic MIF antigen is a variant of a naturally occurring parasite MIF polypeptide, the parasitic MIF antigen may have one or more amino acid substitutions and / or deletions (eg, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, etc.) relative to the parasite MIF polypeptide of natural origin. The variant may comprise a maximum of 5, 10, 15 or 20 substitutions and / or deletions with respect to the parasite MIF polypeptide of natural origin. One or more substitutions may be conservative amino acid replacements, i.e., the replacement of one amino acid with another having a related side chain. Genetically encoded amino acids are generally divided into four families: (1) acids for example aspartate, glutamate; (2) basic for example lysine, arginine, histidine; (3) non-polar e.g. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) without polar charge, for example glycine, asparagine, glutamine, cystine, serine, threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified together as aromatic amino acids. In general, substitution of single amino acids within these families does not have a major effect on biological activity. The variant may also include one or more insertions (for example 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, Etc.) of amino acids (e.g., each of 1, 2, 3, 4 or 5 amino acids) relative to the parasite MIF polypeptide of natural origin. The variant may have a maximum of 5, 10, 15 or 20 insertions relative to the parasite MIF polypeptide of natural origin.
The variant may be encoded by a nucleic acid sequence that can hybridize under strict conditions to a nucleic acid sequence that encodes a parasite MIF polypeptide of natural origin. Hybridization reactions can be performed under different "stringency" conditions. Conditions that increase the stringency of a hybridization reaction are widely known and published in the art (e.g., page 7.52 of reference 9). Examples of suitable conditions include (in order of increasing stringency): incubation temperatures of 25 ° C, 37 ° C, 50 ° C, 55 ° C and 68 ° C; buffer concentrations of 10 x SSC, 6 x SSC, 1 x SSC, 0.1 x SSC (where SSC is 0.15 M NaCl and 15 mM citrate buffer) and their equivalents using other buffer systems; 0%, 25%, 50% and 75% formamide concentrations; incubation times ranging from 5 minutes to 24 hours; 1, 2 or more washing steps; incubation times for washing of 1, 2, or 15 minutes; and washing solutions of 6 x SSC, 1 x SSC, 0.1 x SSC, or demineralized water. Hybridization techniques and their optimization are well known in the art [e.g., see references 9,12, etc.]. Preferably, a nucleic acid sequence encoding a hybrid variant, under high stringency conditions (e.g., 68 ° C and 0.1 x SSC), a nucleic acid sequence that encodes a parasitic MIF polypeptide of natural origin.
In some embodiments, the parasitic MIF antigen is composed of at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100. amino acids in length.
As used herein, the term "antigen" refers to a molecule containing one or more epitopes (eg, linear, conformational, or both) that will stimulate the immune system of the host to give a humoral response and / or immunological specific for the cellular antigen (i.e., an immune response that specifically recognizes a parasitic MIF polypeptide of natural origin). An "epitope" is the portion of an antigen that determines its immunological specificity. The antigen, or a nucleic acid encoding the antigen, can be isolated or purified from a natural source (i.e., a parasite of interest), but will generally be produced by recombinant or synthetic techniques, which will be familiar to humans. persons of the profession.
A parasitic MIF antigen may include at least one T or B cell epitope of the naturally occurring parasite MIF polypeptide. T- and B-cell epitopes can be identified empirically (e.g. using PEPSCAN [13,14] or similar methods), or they can be predicted (for example, using the Jameson-Wolf antigenic index [15]). ], matrix-based approaches [16], TEPITOPE [17], neural networks [18], OptiMer & Epi [19, 20], ADEPT [21], Tsites [22], hydrophilic [23], index antigen [24] or the methods described by reference, etc.).
In some embodiments, the parasitic MIF antigen is capable of eliciting a T-cell response in the subject, for example a helper (CD4) T cell response.
Several parasitic MIF antigens
A composition of the invention may utilize or target a single parasitic MIF antigen, or may use or target two or more different parasitic MIF antigens. Thus, in some embodiments, a composition as defined herein may comprise or encode a single parasitic MIF antigen or two or more different parasitic MIF antigens and / or may comprise antibodies that specifically bind to a parasitic MIF antigen alone. or two or more different parasitic MIF antigens.
In some embodiments, the composition may include a nucleic acid that encodes two or more parasitic MIF antigens. In some embodiments, the composition may include two or more nucleic acids that encode a parasitic MIF antigen. In some embodiments, the composition may include two or more parasitic MIF antigens. In some embodiments, the composition may include two or more antibodies that bind two or more parasitic MIF antigens, respectively.
In some embodiments, a composition of the invention may comprise a combination of: (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. · For example, the composition may comprise a combination of (i) and (ii), (i) and (iii), (ii) and (iii), or (i), (ii) and (iii).
In each of (i), (ii) and (iii), the parasitic MIF antigen may be a different parasitic MIF antigen.
The different parasitic MIF antigens may be derived from different parasite species, may be different variants of a parasitic MIF antigen, or may have different parasitic MIF epitopes. In some embodiments, a composition may comprise or encode two, three, four, or more, parasitic MIF antigens that may contain a series of epitopes. In some embodiments, a composition may have two, three, four or more antibodies that specifically bind to a different parasitic MIF antigen epitope.
Additional parasite antigens
As noted above, the immune response to the parasitic MIF antigen may enhance the development of a protective immune response (e.g., a memory CD4 T cell response) to one or more additional parasite antigens. Thus, MIF parasites can be used either as stand-alone antigens or in combination with additional parasite antigens to promote long-lasting memory T-cell responses and protective immunity against parasite infection.
Thus, a composition as defined herein (i.e., a composition comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen, (ii) a parasitic MIF antigen, or (iii) an antibody which specifically binds to a parasitic MIF antigen) may further comprise or encode one or more additional parasite antigens (parasite antigens that are not parasitic MIF antigens, or "non-MIF parasite antigens"). In some embodiments, the composition may include a nucleic acid sequence that encodes an additional parasite antigen. For example, the composition may comprise a nucleic acid comprising both a sequence that encodes a parasitic MIF antigen and a sequence that encodes an additional parasite antigen (ie, the parasitic MIF antigen and the additional parasite antigen may be encoded by the same nucleic acid molecule). Alternatively, or additionally, the composition may comprise a more advanced nucleic acid comprising a sequence that encodes an additional parasitic antigen (ie, parasitic MIF antigen and additional parasite antigen may be encoded by nucleic acid separated).
In some embodiments, the composition may comprise both parasitic MIF antigen and additional parasite antigen.
Alternatively, or additionally, a composition as defined herein (i.e., a composition comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen, (ii) a parasitic MIF antigen, or iii) an antibody that specifically binds to a parasitic MIF antigen) can be administered to a subject in combination with a more advanced composition that comprises or encodes one or more additional parasite antigens. The more advanced composition may further be a parasite vaccine composition. For example, one or more additional parasitic antigens may be formulated as a parasite vaccine composition. In some embodiments, a composition as defined herein may be administered to a subject in combination with a more advanced composition that comprises a nucleic acid comprising a sequence that encodes an additional parasite antigen. In some embodiments, a composition as defined herein may be administered to a subject in combination with a more advanced composition that includes additional parasite antigen.
Alternatively, in some embodiments, a method for providing protective immunity against parasitic infection in a subject in need of such treatment according to the present invention may further include administering to a more advanced composition that includes a nucleic acid. comprising a sequence that encodes an additional parasite antigen. In some embodiments, a method for providing protective immunity against parasitic infection in a subject in need of such treatment in accordance with the present invention may further comprise administering to a composition which further comprises an additional parasite antigen. .
Thus, in a method for providing protective immunity against parasitic infection in a subject in need, according to the present invention, the subject may be administered to: (1) a composition as defined herein, which comprises a nucleic acid comprising a sequence which encodes a parasitic MIF antigen and a more advanced composition which comprises a nucleic acid comprising a sequence which encodes an additional parasite antigen; (2) a composition as defined herein, which comprises a nucleic acid comprising a sequence which encodes a parasitic MIF antigen and a more advanced composition which comprises an additional parasite antigen; (3) a composition as defined herein which comprises a parasitic MIF antigen and a composition which further comprises a nucleic acid comprising a sequence which encodes an additional parasite antigen; (4) a composition as defined herein which comprises a parasitic MIF antigen and a more advanced composition which comprises additional parasite antigen; (5) a composition as defined herein which comprises an antibody that specifically binds to a parasitic MIF antigen and a more advanced composition which comprises a nucleic acid comprising a sequence that encodes an additional parasite antigen; or (6) a composition as defined herein, which comprises an antibody that specifically binds to a parasitic MIF antigen and a more advanced composition that includes additional parasite antigen.
The composition as defined herein (i.e., a composition comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen, (ii) a parasitic MIF antigen, or (iii) an antibody that binds specifically to a parasitic MIF antigen) and the composition comprising or encoding the additional parasite antigen can be provided as separate components and / or administered separately. Alternatively, the composition as defined herein (e.g., a composition comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen, (ii) a parasitic MIF antigen, or (iii) an antibody that specifically binds to a parasitic MIF antigen) and the composition comprising or encoding the additional parasite antigen may be mixed prior to administration. The administration of (A) the composition as defined herein (i.e., a composition comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MI F antigen, (ii) a parasitic MIF antigen or ( iii) an antibody that specifically binds to a parasitic MIF antigen); and (B) the composition comprising or encoding the additional parasite antigen, in any combination as described hereinafter, may be contemporaneous. For example, compositions (A) and (B) may be administered concurrently, separately or sequentially. The compositions (A) and (B) can be administered within 12 months of each other, within 6 months of each other, or within one month or less of each other ( for example, within 10 days). The compositions (A) and (B) can be administered within 7 days, within 3 days, within 2 days, or within 24 hours of each other. Simultaneous administration may involve the administration of compositions (A) and (B) at the same time. Simultaneous administration may include administering (A) and (B) to a patient at 12-hour, 6-hour, 3-hour, 2-hour, or 1-hour intervals, usually during the same visit to a clinical center. The composition (A) can be administered before (B).
In some embodiments, the additional parasite antigen may be derived from the same species of parasites as the parasitic MIF antigen. In other embodiments, the additional parasite antigen may be of a different species than the parasitic MIF antigen.
One or more other parasite antigens may, for example, be Plasmodium antigens, or derived from Plasmodium antigens, such as circumsporozoite (CS) protein (possibly fused to a surface antigen of hepatitis B virus (HBsAg )); merozoite surface protein (MSP), for example MSP-1; reticulocyte binding protein (RH5) homologue, for example, PfRH5; apical membrane antigen 1 (AMA1); thrombospondin-related adhesion protein (TRAP); ΜΕ-TRAP (multiple epitope segment with thrombospondin-related adhesion proteins: a pre-erythrocyte fusion antigen consisting of 17 B cells, CD4 + and CD8 + T cell epitopes from six P. falciparum antigens fused to the TRAP T9 / 96 allele); hepatic stage 1 antigen (LSA-1); hepatic antigen-3 stage (LSA-3); exported protein 1 (Exp-1); antigen encoded by EP1300 polyepitope DNA with binding sequences of four pre-erythrocyte antigens, CS, TRAP, LSA-1 and Exp-1; polyprotein comprising LSA-3, asparagine-rich protein, threonine and sporozoite (STARP), Expl, Pfs16, TRAP, and LSA-1; a P. falciparum merozoite protein (FMP) such as FMP010 or FMP001; 3-merozoite surface protein (MSP-3); antigen-175 erythrocyte binding (EBA175); EBA175 RII; serine repeat antigen (SERA5); SE36, a recombinant protein corresponding to a fragment of the SERA5 antigen; glutamate-rich protein (GLURP); surface antigen of ring-infected erythrocyte (RESA); antigenic fragments of any of the foregoing; or a combination of both. In some embodiments, one or more other antigens may be in the form of non-replicating sporozoites, such as PfSPZ (which consists of attenuated, aseptic, purified, cryopreserved Plasmodium falciparum sporozoites) (eg Seder et al. Science 341, 1359 (2013)).
In some embodiments, an additional parasite antigen for use with the invention is a CS protein, which comprises P. falciparum antigens based on the circumsporozoite protein (CS). This may take the form of a recombinant protein that fuses a portion of the CS protein with HBsAg, known as "RTS," or TRAP. The P. falciparum antigens suitable for making HBsAg hybrids may be based on a subunit of the circumsporozoite surface antigen ("CSP"). For example, they may include between 3 and 20 repeats of its PNNA motif, and / or they may include the C-terminal region of CSP (but generally do not include the last 12 amino acids of the C-terminus). RTS is a hybrid protein comprising substantially all of the C-terminal portion of CS of NF54 or 7G8 isolate of P. falciparum (amino acids 210-398, which comprises 19 PNNA repeats and in the acid T cell epitope region). amines 367 to 390), fused to the N-terminal of the four amino acid HBsAg of the preS2 portion of HBsAg [26]. The sequence of RTS may therefore contain: (i) an N-terminal methionine residue; (ii) Met-Ala-Pro; (iii) 189 amino acids corresponding to amino acids 210-398 of the P. falciparum 7G8 CS protein or amino acids 207-395 of P. falciparum NF54 CS protein; (iv) Arg or Gly; (v) Pro-Val-Thr-Asn protein from hepatitis B virus Pre-S2 protein; and (vi) HBsAg. When expressed in yeast (particularly in S. cerevisiae), RTS is produced as a lipoprotein particle (including in particular phospholipids), and when co-expressed with HBV S antigen, it produces a mixed particle called RTS, S. An RTS: S ratio of about 1: 4 is useful. The TRAP antigens are described in reference 27. In some embodiments, additional parasite antigen may take the form of RTS, S.
One or more additional parasitic antigens may be from all Plasmodium species, including the Plasmodium species listed below. In some embodiments, the additional parasite antigen is a Plasmodium falciparum or Plasmodium vivax antigen. In some embodiments, the additional parasite antigen is a CS protein (optionally fused with HBsAg); MSP-1; PfRH5; AMAl; and antigenic fragments thereof. For example, the parasitic MIF antigen may be a Plasmodium falciparum MIF antigen and the additional parasite antigen may be a Plasmodium falciparum circumsporozoite protein (CS) fused to a surface antigen of the hepatitis B virus (HBsAg). ).
In other embodiments, one or more other additional parasite antigens may be Leishmania antigens, or derived from Leishmania antigens, as thiol-specific antioxidant (TSA); stress inducible protein 1 (LmSTI1); initiation factor of Leishmania elongation (LelF); recombinant surface antigen gp63; lipophosphoglycan; a 46 kD promastigote antigen derived from L. amazonensis; Leishmania-activated kinase C (LACK); parasite surface antigen (PSA); and parasite surface antigen-2 (PSA-2); Schistosoma antigens such as myosin parasite of 63 kD; paramyosin 97 kD; triose phosphate isomerase (TPI) 28 kD; 23 kD integral membrane protein (Sm23); GST of 26 and 28 kDa; 28 kD S. haematobium GST (Sh28GST); Tetraspanin-2 (SmTSP-2) and fatty acid binding protein (FABP). They may be Ancyclostoma antigens or antigens derived from the Ancylostoma, such as the secreted protein Ancylostoma (ASP); they may be antigens or antigens derived from Necator, such as Na-ASP-2, a 21 kDa protein from Necator americanus; any of the above antigenic fragments, or a combination thereof.
A composition of the invention may also be used in a method for enhancing an immune response to another parasite antigen (e.g., non-MIF) (e.g., another Plasmodium antigen, as described herein). Thus, there is provided here a method for improving an immune response to a parasite antigen, comprising administering a composition of the invention (e.g., a composition comprising (i) a nucleic acid comprising a sequence that encodes an antigen Parasitic MIF, (ii) an antigen MIF parasite, and / or (iii) an antibody that specifically binds to a parasitic MIF antigen) to a subject. The parasite antigen against which the immune response is enhanced may include one or more other parasitic antigens as defined herein. The method may also include administering a non-MIF parasite antigen to the subject. MIF and non-MIF antigens can be administered simultaneously, separately, or sequentially.
The immune response can be improved over the immune response in a subject treated with the non-MIF parasite antigen only. The improved immune response may include an improved protective immune response against parasite infection. Protective immune responses are defined here. For example, the protective immune response may be characterized by an immune memory (e.g., a response of the protective memory T cells) against the parasite. Protective immunity may be sterilizing immunity.
polypeptides
In some embodiments, a polypeptide according to the present invention is in a non-natural form (e.g., a recombinant or modified form).
For example, the polypeptides (e.g., antigens) described herein may be prepared by chemical synthesis (in whole or in part), by digestion of longer polypeptides with proteases, by translation of RNA, by purification from cell culture (eg, from recombinant expression), the organism itself, etc. An example of a process for the production of peptides <40 amino acids long involving in vitro chemical synthesis [28, 29]. Solid phase peptide synthesis techniques, such as tBoc-based methods or Fmoc chemistry [30] are known in the art. Enzymatic synthesis [31] can also be used in whole or in part. As an alternative to chemical synthesis, biological synthesis can be used. For example, the polypeptides can be produced by translation. This can be done in vitro or in vivo. Biological methods are generally limited to the production of polypeptides derived from L-amino acids, but the manipulation of translation machines (for example aminoacyl-tRNA molecules) can be used to allow the introduction of amino acids D (or other unnatural amino acids, such as iodotyrosine or methylphenylalanine, azidohomoalanine, etc.) [32]. Where D-amino acids are included, it is best to use chemical synthesis. The polypeptides of the description may have covalent modifications at the C-terminus and / or N-terminus. They can also take various forms (for example native, fusions, non-glycosylated glycosylated, lipidated, non-lipidated, phosphorylated, non-phosphorylated, myristoylated, non-myristoylated, monomeric, multimeric, particulate, denatured, etc.). The polypeptides may be naturally or non-naturally glycosylated (ie, the polypeptide may have a glycosylation profile that differs from the glycosylation pattern found in the corresponding natural polypeptide).
The unnatural polypeptide forms of the invention may comprise one or more heterologous amino acid sequences (eg, another antigen sequence or a detectable tag) in addition to a parasitic MIF antigen sequence. For example, a polypeptide of the invention may be a fusion protein. Alternatively, or additionally, the amino acid sequence or chemical structure of the polypeptide may be modified (for example with one or more unnatural amino acids, by covalent modification, and / or by having a different glycosylation profile, by for example, by removing or adding one or more groups of glycosyls) relative to a natural polypeptide sequence.
The polypeptides (e.g., antigens) described herein are preferably provided in purified or substantially purified form ie substantially free of other polypeptides (eg, free from naturally occurring polypeptides), particularly other host cell polypeptides or parasite; for example, at least about 50% purity (by weight), at least about 60% purity (by weight), at least about 70% purity (by weight), at least about 80% purity (by weight) , or at least 90% purity, etc. On the other hand, less than 50%, less than about 40%, less than about 30%, less than 20%, less than about 10%, less than about 5% of a composition comprises other expressed polypeptides.
Nucleic Acids The invention also relates to nucleic acids having a sequence that encodes a parasitic MIF antigen as set forth herein. The nucleic acid according to the invention can take various forms (for example single-stranded, double-stranded, vectors, etc.). The nucleic acids of the invention may be circular or branched, but will generally be linear.
The nucleic acids used in the invention are preferably provided in purified or substantially purified form ie substantially free of other nucleic acids (eg, free of natural nucleic acids), particularly other parasitic or cellular nucleic acids. of the host, generally being at least about 50% purity (by weight), and usually at least about 90% pure.
The nucleic acids can be prepared in several ways, for example by chemical synthesis (eg, DNA synthesis phosphoramidite), in whole or in part, by digestion of the longer nucleic acids using nucleases (eg restriction enzymes ), joining shorter nucleotides or nucleic acids (eg using ligases or polymerases), from genomic or cDNA libraries, etc.
The term "nucleic acid" generally refers to a polymeric form of nucleotides of any length, which contains deoxyribonucleotides, ribonucleotides and / or their analogs. This includes hybrids of DNA, RNA, DNA / RNA. This also includes DNA or RNA analogs, such as those containing modified backbones (e.g., peptide nucleic acids (PNAs) or phosphorothioates) or modified bases. Thus, the nucleic acid of the invention comprises mRNA, DNA, cDNA, recombinant nucleic acids, branched nucleic acids, plasmids, vectors, etc. When the nucleic acid takes the form of RNA, there may or may not be a 5 'plug.
The nucleic acids of the invention comprise a sequence that encodes at least one parasitic MIF antigen. In general, the nucleic acids of the invention will be in recombinant form, ie a form that does not occur in nature. For example, the nucleic acid may comprise one or more heterologous nucleic acid sequences (e.g., a sequence encoding another antigen and / or a control sequence such as a ribosome internal promoter or entry site) in addition to the sequence coding for at least one parasitic MIF antigen. The nucleic acid may be part of a vector i.e. a part of a nucleic acid construct designed for transduction / transfection of one or more types of cells. The vectors may be, for example, "expression vectors" that are designed for the expression of a nucleotide sequence in a host cell, or "viral vectors" that are designed to result in the production of a recombinant virus or a particle of the viral type.
Alternatively, or in addition, the sequence or chemical structure of the nucleic acid may be modified from a naturally occurring sequence that encodes a parasitic MIF antigen. The sequence of the nucleic acid molecule may be modified, for example to increase the expression efficiency or replication of the nucleic acid, or to provide additional stability or resistance to degradation. For example, the sequence of the nucleic acid molecule can be codon optimized for expression in a desired host, such as a mammalian (eg, human) cell. Such a change in codon usage may increase translational efficiency and half-life of the nucleic acid. A polyA tail (e.g., of about 30 or more adenosine residues) may be attached to the 3 'end of the RNA to increase its half-life. The 5 'end of the RNA can be capped with one. ribonucleotide modified with the structure m7G (5 ') ppp (5') N (structure cap 0) or a derivative thereof, which can be incorporated during the synthesis of RNA or can be designed enzymatically after transcription of RNA (for example, using the enzyme Vaccinia Virus Capping Enzyme (VCE) composed of mRNA triphosphatase, guanylyl-transferase and guanine-7-methyltransferase, which catalyzes the construction of N7-monomethylated cap 0 structures). The Cap 0 structure plays an important role in maintaining the stability and efficiency of the translation of the RNA molecule. The 5 'cap of the RNA molecule can be modified by a 2' - O - methyltransferase which results in the generation of a cap 1 structure (m7Gppp [m2 '- O] N), which can further increase the translation efficiency.
The nucleic acids may include one or more nucleotide analogs or modified nucleotides. Like those used herein, the "nucleotide analog" or "modified nucleotide" refers to a nucleotide that contains one or more chemical modifications (e.g., substitutions) in or on the nucleotide base of the nucleoside (e.g. eg cytosine (C), thymine (T) or uracil (U)), adenine (A) or guanine (G)). A nucleotide analogue may contain other chemical modifications in or on the sugar portion of the nucleoside (eg ribose, deoxyribose, modified ribose, modified deoxyribose, six-membered sugar analog or open-chain sugar analogue), or phosphate. The preparation of nucleotides and modified nucleotides and nucleotides is well known in the art, for example US Pat. Nos. 4,373,071, 4,458,066, 4,500,707, 4,668,777, 4,973,679, 5,047,524, and 5,132. 418, 5,153,319, 5,262,530, 5,700,642, and many modified nucleosides and modified nucleotides are commercially available.
The modified nucleobases that can be incorporated into modified nucleosides and nucleotides and be present in the RNA molecules include: m5C (5-methylcytidine), m5U (5-methyluridine), M6A (N6-methyladenosine), S2U (2-thiouridine) ), Um (2'-O-methyluridine), M1A (1-methyladenosine); m2A (2-methyladenosine); Am (2-1-O-methyladenosine); ms2m6A (2-methylthio-N6-methyladenosine); I6A (N6-isopentenyladenosine); ms2i6A (2-methylthio-N-isopentenyladenosine); io6A (N6- (cis-hydroxyisopentenyl) adenosine); ms2io6A (2-methylthio-N6- (cis-hydroxyisopentenyl) adenosine); G6A (N6-glycinylcarbamoyladenosine); T6a (N6-threonyl carbamoyladenosine); ms2t6A (2-methylthio-N6-threonyl carbamoyladenosine); m6t6A (N6-methyl-N-threonylcarbamoyladenosine); hn6A (adenosine N6-hydroxynorvalylcarbamoyl); ms2hn6A (carbamoyladenosine 2-methylthio-N6-hydroxynorvalyl); Ar (p) (2'-O-ribosyladenosine (phosphate)); I (inosine); Mli (1-methylinosine); Im (1,2-O-dimethylinosine); M3C (3-methylcytidine); Cm (2T-O-methylcytidine); S2C (2-thiocytidine); ac4c (N4-acetylcytidine); F5C (5-butylcytidine); m5Cm (5,2-O-dimethylcytidine); ac4Cm (N4acetyl2TOmethylcytidine); K2C (lysidine); M1G (1-methylguanosine); M2G (N2-methylguanosine); m7G (7-methylguanosine); Gm (2'-O-methylguanosine); m22G (N2, N2-dimethylguanosine); m2Gm (N2,2'-O-dimethylguanosine); m22Gm (N2, N2,2'-O-trimethylguanosine); Gr (p) (2'-O-ribosylguanosine (phosphate)); y (wybutosine); o2yW (peroxywybutosine); OHyW (hydroxywybutosine); OHyW * (disrupted hydroxywybutosine); IMG (wyosine); MIMG (methylguanosine); Q (queuosin); oQ (epoxyqueuosine); Galq (galtactosyl-queuosine); manQ (mannosyl-queuosine); preQo (7-cyano-7-deazaguanosine); preQi (7-aminomethyl-7-deazaguanosine); G * (archaeosine); D (dihydrouridine); m5Um (5,2'-O-dimethyluridine); S4U (4-thiuridine); m5s2U (5-methyl-2-thiouridine); S 2 Um (2-thio-2'-O-methyluridine); acp3U (3- (3-amino-3-carboxypropyl) uridine); ho5U (5-hydroxyuridine); mo5U (5-methoxyuridine); cmo5U (5-oxyacetic acid uridine); mcmo5U (uridine 5-oxyacetic acid methyl ester); chm5u (5- (carboxyhydroxymethyl) uridine)); mchm5U (methyl 5- (carboxyhydroxymethyl) uridine ester); mcm5U (5-methoxycarbonyl methyluridine); mcm5Um (S-methoxycarbonylmethyl-2-O-methyluridine); mcm5S2U (5-methoxycarbonylmethyl-2-thiouridine); nm5s2U (5-aminomethyl-2-thiouridine); mnm5U (5-methylaminomethyluridine); MnO5S2U (5-methylaminomethyl-2-thiouridine); mnm5se2U (5-methylaminomethyl-2-selenouridine); ncm5U (5 carbamoylmethyl uridine); ncm5Um (5-carbamoylmethyl-2'-O-methyluridine); cmnm5U (5-carboxymethylaminomethyluridine); (5 carboxymethylaminomethyl-2-L-0methyluridine); cmnm5s2U (5-carboxymethylaminomethyl-2-thiouridine); m62A (N6, N6-dimethyladenosine); Tm (2'-O-methylinosine); M4C (N4-methylcytidine); m4Cm (N4,2-O-dimethylcytidine); hm5C (5-hydroxymethylcytidine); M3U (3-methyluridine); cm5U (5-carboxymethyluridine); m6Am (N6, T-O-dimethyladenosine); rn62Am (N6, N6, 0-2-trimethyladenosine); m2'7G (N2,7-dimethylguanosine); m2'2'7G (N2, N2,7-trimethylguanosine); m3Um (3,2T-O-dimethyluridine); M5D (5-methyldihydrouridine); 5Cm (5-formyl-2'-O-methylcytidine); mlGm (1,2'-O-dimethylguanosine); Me am (1,2-dimethyl-O-adenosine) irinomethyluridine); tm5s2U (S-taurinomethyl-2-thiouridine)); img-14 (4-demethyl guanosine); IMG2 (isoguanosine); ac6A (N6-acetyladenosine), hypoxanthine, inosine, 8-oxo-adenine, 7-substituted derivatives thereof, dihydrouracil, pseudouracil, 2-thiouracil, 4-thiouracil, 5-aminouracil, 5- (Οι -Οβ) alkyluracil, 5-methyluracil, 5- (C2-C6) -alkenyluracil, 5- (C2-C6) -alkynyluracil, 5- (hydroxymethyl) uracil, 5-chlorouracil, 5-fluorouracil, 5-bromide, uracil, 5-hydroxycytosine, 5- (C 1 -C 6) -alkylcytosine, 5-methylcytosine, 5- (C 2 -C 6) alkenylcytosine, 5- (C 2 -C 6) -alkynylcytosine, 5-chlorocytosine, 5-fluorocytosine, -bromocytosine, N2-dimethylguanine, 7-deazaguanine, 8-azaguanine, 7-deaza-7-substituted guanine, 7-deaza-7- (C 2 -C 6) alkynylguanine, 7-deaza-8-substituted guanine, 8-hydroxyguanine, 6-thioguanine, 8-oxoguanine, 2-aminopurine, 2-amino-6-chloropurine, 2,4-diaminopurine, 2,6-diaminopurine, 8-azapurine, substituted 7-deazapurine, 7-deazapine 7-substituted purine, 8-7-deaza-substituted purine, hydrogen (abasic residue) m5C, iu5U, m6A, s2U, W, or 2'-Om Thyle-U. Many of these modified nucleobases and their corresponding ribonucleosides are available from commercial suppliers. See for example WO 2011/005799.
Nucleic acid vaccines
A composition as set forth herein comprising a nucleic acid sequence that encodes a parasitic MIF antigen that could be a nucleic acid vaccine. Another composition comprising a nucleic acid sequence that encodes one or more additional parasite antigens may also be provided as a nucleic acid vaccine. The nucleic acid can be, for example, RNA (for example an RNA-based vaccine) or DNA (for example a DNA-based vaccine, such as a plasmid DNA vaccine). . In some embodiments, the nucleic acid vaccine is an RNA based vaccine. In some embodiments, the RNA-based vaccine comprises a self-replicating RNA molecule.
The self-replicating RNA molecule may be an alphavirus-derived RNA replicon.
Self-replicating RNA molecules are well known in the art and can be produced using derived replication elements, e.g., alphaviruses, and replacing structural viral proteins with a nucleotide sequence encoding a protein of interest. A self-replicating RNA molecule is typically a + strand molecule, which can be directly translated after delivery to a cell, and this translation provides an RNA-dependent RNA polymerase which then produces two antisense transcripts and sense of delivered RNA. Thus, the delivered RNA leads to the production of multiple daughter RNAs. These daughter RNAs, as well as collinear subgenomic transcripts, can be converted themselves to provide in situ expression of an encoded antigen (e.g. parasitic MIF antigen), or can be transcribed to provide transcripts with the same meaning that the delivered RNA, which are translated to give the expression of the antigen in situ. The overall result of this transcript sequence is an enormous boost in the number of introduced replicon RNAs and thus the encoded antigen becomes a major polypeptide product of the cells.
A suitable system for performing self-replication in this way is to use an alphavirus-based replicon. These replicons are + RNAs that lead to the translation of a replicase (or replicase-transcriptase) after delivery to a cell. The replicase is translated as a polyprotein that separates automatically to provide a replication complex that creates genomic copies of the + ARM strand delivered. These -branched transcripts can themselves be transcribed to give more copies of the + strand of parent RNA and also to give a subgenomic transcription that encodes the antigen. The translation of subgenomic transcription thus leads to the in situ expression of the antigen by the infected cell. The appropriate alphavirus replicons can use a replicase of a Sindbis virus, a Semliki forest virus, an Eastern equine encephalitis virus, a Venezuelan equine encephalitis virus, etc. Mutants or wild-type virus sequences can be used, for example the attenuated mutant of VEEV TC83 was used in replicons [33].
In some embodiments, the self-replicating RNA molecule described herein encodes (i) an RNA-dependent RNA polymerase that can transcribe RNA from the self-replicating RNA molecule and (ii) a parasitic MIF antigen. The polymerase may be an alphavirus replicase, for example, comprising one or more of the alphavirus proteins nsP1, nsP2, nsP3 and nsP4.
While natural alphavirus genomes encode virion structural proteins, in addition to the non-structural replicase polyprotein, in some embodiments, self-replicating RNA molecules do not encode structural alphavirus proteins. Thus, self-replicating RNA can lead to the production of genomic RNA copies of itself in a cell, but not to the production of virions containing RNA. The inability to produce these virions means that, unlike to a wild-type alphavirus, the self-replicating RNA molecule can not be maintained in infectious form. The alphavirus structural proteins that are necessary for the perpetuation of wild-type viruses are absent from the self-replicating RNA of the present publication and their place is taken by the gene (s) encoding the immunogen of interest, so that subgenomic transcription encode the immunogen rather than the structural alpion virion proteins.
Thus, a self-replicating RNA molecule useful in the invention can have two open reading frames. The first open reading frame (5 ') encodes a replicase; the second open reading frame (3 ') encodes an antigen. In some embodiments of the RNA may have additional open reading frames (eg downstream) for example to encode other antigens or to encode accessory polypeptides.
In some embodiments, the self-replicating RNA molecule described herein has a 5 'cap (e.g. 7-methylguanosine). This plug can enhance in vivo translation of RNA. In some embodiments, the 5 'sequence of the self-replicating RNA molecule must be chosen to ensure compatibility with the encoded replicase.
A self-replicating RNA molecule may have a 3 'poly-A tail. It may also comprise a poly-A polymerase recognition sequence (eg AAUAAA) near its 3 'end.
The self-replicating RNA molecules may have different lengths, but they are usually 5,000 to 25,000 nucleotides long. The self-replicating RNA molecules will generally be single-stranded. In general, single-stranded RNAs can initiate an adjuvant effect by binding to RNA helicases, TLR7, TLR8, and / or PKR. Double-stranded RNAs (dsRNAs) can bind to TLR3, and this receptor can also be triggered by the dsRNA that is formed either during single-stranded RNA replication or within the secondary structure. a single-stranded RNA. Self-replicating RNA can be conveniently prepared by in vitro transcription (IVT). IVT can use a model (cDNA) created and propagated as plasmids in bacteria or created synthetically (eg by gene synthesis and / or by polymerase chain reaction (PCR) engineering methods). For example, a DNA-dependent RNA polymerase (such as bacteriophage T7, T3 or SP6 RNA polymerases) can be used to transcribe self-replicating RNA from a DNA template. Additional reactions of appropriate caps and poly-A may be used as required (although the poly-A replicon is usually encoded within the DNA template). These RNA polymerases may have stringent requirements for the 5 'transcript nucleotide (s) and some embodiments of these requirements must be tailored to the requirements of the encoded replicase, to ensure that the IVT-RNA is transcribed can function effectively as a substrate for its self-encoded replicase.
A self-replicating RNA may comprise (in addition to any 5 'cap structure) one or more nucleotides having a modified nucleobase. An RNA used with the present invention ideally comprises only phosphodiester bonds between the nucleosides, but in some embodiments it may contain phosphoramidate, phosphorothioate and / or methylphosphonate linkages.
The self-replicating RNA molecule can encode a single heterologous polypeptide antigen (e.g., parasitic MIF antigen) or, optionally, two or more heterologous polypeptide antigens bound together so that each of the sequences retain its identity (e.g. connected in series) when expressed as an amino acid sequence. The heterologous polypeptides produced from the self-replicating RNA can then be produced as a fusion polypeptide or designed to give rise to distinct peptide or polypeptide sequences.
The above-described RNA self-replicating molecules can be engineered to express multiple nucleotide sequences from two or more open reading frames, allowing the co-expression of proteins, such as one, two or more parasite antigens (eg, one, two or more parasitic MIF antigens) with cytokines or other immunomodulators, which can enhance the generation of an immune response. Such a self-replicating RNA molecule may be particularly useful, for example, in the production of various gene products (eg, proteins) at the same time, for example, as a bivalent or multivalent vaccine.
If desired, self-replicating RNA molecules can be screened or analyzed to confirm their therapeutic and prophylactic properties using different in vitro or in vivo test methods that are known to those skilled in the art. For example, vaccines comprising the self-replicating RNA molecule can be tested for their effect on proliferative induction or effector function of the lymphocyte type of particular interest, for example, B cells, T cells, T cell lines and T cell clones. For example, spleen cells from immunized mice can be isolated and the ability of cytotoxic T lymphocytes to lyse autologous target cells that contain an RNA molecule. self-replicating which encodes a parasitic MIF antigen. In addition, differentiation of helper T cells can be analyzed by measuring the proliferation or production of TH1 (IL-2 and IFN-gamma) and / or TH2 (IL-4 and IL-5) cytokines by ELISA or directly in CD4 + T cells by cytokine cytoplasmic staining and flow cytometry.
Self-replicating RNA molecules that encode a parasitic MIF antigen can also be tested for their ability to induce humoral immune responses, as evidenced, for example, by the induction of B cells to produce antigen-specific antibodies. MIF parasitic of interest. These assays can be performed using, for example, peripheral B cells of immunized individuals. These assay methods are known to those skilled in the art. Other assays that can be used to characterize self-replicating RNA molecules that may involve the detection of parasite MIF antigen expression encoded by the target cells. For example, FACS can be used to detect expression of the antigen on the cell or intracellular surface. Another advantage of FACS selection is that one can sort for different levels of expression; the sometimes inferior expression may be desirable. Another suitable method for identifying cells that express a particular panoramic antigen using monoclonal antibodies on a plate or capture using magnetic beads coated with monoclonal antibodies.
Suitable types of nucleic acid vaccines to be used in accordance with this disclosure are described in references 34, 35 and 36.
The viral nucleic acid vaccine may include a viral system or a non-viral delivery system. The delivery system (also referred to herein as the delivery vehicle) may have adjuvant effects that enhance the immunogenicity of the coded parasitic MIF antigen. For example, the nucleic acid molecule may be encapsulated in liposomes, non-toxic biodegradable polymer microparticles or viral replicon particles (VRP), or complexed with particles of an oil-water type cationic emulsion. In some embodiments, the nucleic acid vaccine is comprised of a cationic nanoemulsion (CNE) delivery system or a lipid nanoparticle (LN) delivery system. On the other hand, the nucleic acid vaccine may comprise viral replicon particles. In other embodiments, the nucleic acid vaccine may comprise a naked nucleic acid, such as naked RNA (mRNA, for example), but delivery via LNP is preferable.
In some embodiments, the nucleic acid vaccine comprises a cationic nanoemulsion delivery system (CNE). The delivery systems and CNE methods for their preparation are described in reference 35. In a CNE delivery system, the nucleic acid molecule (eg RNA) that codes for the antigen is complexed with a particle of a typical cationic emulsion. oil-water. The cationic oil-water emulsions can be used to deliver negatively charged molecules, such as an RNA molecule to the cells. The emulsion particles comprise an oil core and a cationic lipid. The cationic lipid can interact with the negatively charged molecule thereby anchoring the molecule to the particles of the emulsion. Other useful CNE details can be found in references 35, 37 &amp; 38 (the complete contents of all that are incorporated herein by reference).
Thus, in a nucleic acid vaccine of the invention, an RNA molecule encoding a parasitic MIF antigen may be complexed by a particle of a cationic oil-water emulsion. The particles typically comprise an oil core (for example a vegetable oil or squalene) which is in the liquid phase at 25 ° C, a cationic lipid (for example, phospholipids) and, optionally, a surfactant (for example trioleate). sorbitan, polysorbate 80); polyethylene glycol may also be included. In some embodiments, CNE comprises squalene and a cationic lipid, such as 1,2-dioleoyloxy-3- (trimethylammonio) propane (DOTAP). In some preferred embodiments, the delivery system is a non-viral delivery system, such as CNEs, and the nucleic acid vaccine comprises self-replicating RNA (mRNA). This can be particularly effective in inducing humoral and cellular immune responses. The benefits also include the absence of an anti-limiting vector immune response and no risk of genomic integration.
LNP delivery systems and non-toxic biodegradable polymeric microparticles, and methods for their preparation are described in references 34 and 36. LNPs are non-virion liposome particles in which a nucleic acid molecule (eg RNA example) can be encapsulated. The particles may include an external RNA (for example on the surface of the particles), but at least half of the RNA (and ideally all) is encapsulated. The liposomal particles may, for example, be formed of a mixture of zwitterionic, cationic and anionic lipids which may be saturated or unsaturated, for example, DSPC (zwitterionic, saturated), DlinDMA (unsaturated cationic) and / or DMG (anionic). , saturated). Preferred LNPs for use with the invention include an amphiphilic lipid capable of forming liposomes, optionally in combination with at least one cationic lipid (such as DOTAP, DSDMA, DODMA, DLinDMA, DLenDMA, etc.). A mixture of DSPC, DlinDMA, PEG-DMG and cholesterol is particularly effective. Other useful LNPs are described in references 34 and 39-43 (the complete contents of all of which are hereby incorporated by reference). In some embodiments, the liposomes are LNPS RV01 (references 34 and 36).
Antibody
In one aspect, the invention is directed to an antibody that specifically binds to a parasitic MIF antigen as set forth herein. Preferably, the antibody specifically binds to a parasitic MIF antigen of natural origin.
An antibody that "specifically binds" to a parasitic MIF antigen is an antibody that binds to that antigen with greater affinity and / or avidity than it binds to other parasite or non-parasite antigens. For example, the antibody that specifically binds to a parasitic MIF antigen can bind the parasitized MIF antigen with greater affinity and / or avidity than it binds to HSA. Preferably, the antibody does not expressly bind to the vertebrate MIFs or MIF antigen produced by the subject.
As used herein, the term "antibody" includes full length or any antibody (i.e., in substantially intact form thereof), antibody fragments such as F (ab ') 2, F (ab), and Fab -SH fragments, Fv fragments (non-covalent heterodimers), single chain antibodies such as single chain Fv (scFv) molecules or those derived from camels and sharks (eg heavy chain antibodies), domain antibodies single (plots), diabodies, minibodies, oligobodies, etc. The term "antibody" does not imply a particular origin and includes antibodies obtained through unconventional methods, such as phage display. All antibodies will make up the antigen binding site of a full-length or whole antibody and thus retain the ability to bind the antigen. Thus, the term "antibodies" includes antigenic fragments of full length or whole antibodies. The antibody is ideally a monoclonal antibody or, alternatively, may be polyclonal. The antibody can be chimeric, humanized (eg, references 44 &amp; 45), or completely human. In the compositions of the invention, the polyclonal antibodies, comprising one or more of the antibodies that specifically bind to the parasitic MIF antigen, may be used. In certain preferred embodiments, the concordate comprises polyclonal antibodies, for example the anti-parasitic serum MIF antibody. The polyclonal antibodies may include IgG (eg purified IgG serum). The antibodies may include a neutralizing antibody (i.e., an antibody that neutralizes the biological effects of the MIF parasite in the subject). The antibody is preferably provided in purified or substantially purified form. Generally, the antibodies will be present in a composition that is effectively without other polypeptides, for example, where less than 90% (by weight), generally less than 60%, and most usually less than 50% of the composition is made. other polypeptides.
The antibodies can be of any isotype (eg, IgA, IgG, IgM ie .gamma., Or .gamma., But will generally be IgG. Within the IgG isotype, the antibodies may be an IgG1, IgG2, IgG3 or IgG4 subclass. The antibody may have a κ or λ light chain.
Parasites
The present invention relates to the treatment of parasitic infections using parasitic MIF antigens. The parasite (for example the causative agent of the parasitic infection and the parasite from which the parasitic MIF antigen is derived) may be an invertebrate parasite, for example a protozoan or a helminth. The parasite may, for example, be a blood-transmissible parasite (a parasite having a life cycle that involves a step in the blood). The parasites of the invention necessarily express a MIF ortholog (i.e., a naturally occurring MIF polypeptide).
Protozoan parasites include apicomplex parasites, such as Plasmodium spp., Toxoplasma spp., Eimeria spp., Babesia spp., Theileria spp., Neospora spp., And Sarcocystis spp. Other examples of hemoflagellate protozoan parasites, such as Leishmania spp. and Trypanosoma spp., and the other with protozoan flagellae such as Giardia spp.
Plasmodium spp. includes Plasmodium falciparum, Plasmodium berghei (eg ANKA strain), Plasmodium yoelii, Plasmodium chabaudi, Plasmodium vivax, Plasmodium knowlesi, Plasmodium ovale, Plasmodium malariae, and Plasmodium vinckei. Toxoplasma spp. includes Toxoplasma gondii. Eimeria spp. includes Eimeria tenella and Eimeria acervulina. Babesia spp. includes Babesia microti, Babesia divergens, and Babesia duncani. Theileria spp. includes Theileria annulata, Theileria parva, Theileria equi and Theileria orientalis. Neospora spp. includes Neospora caninum. Sarcosystis spp. includes Sarcocystis neuron. Leishmania spp. includes Leishmania major, Leishmania tropica, Leishmania aethiopica, Leishmania infantum (or Leishmania chagasi), Leishmania donovani, Leishmania amazonensis and Leishmania braziliensis. Trypanosoma spp. includes Trypanosoma brucei (subspecies gambiense, rhodesiense, or brucei), and Trypanosoma cruzi. Giardia spp. includes Giardia lamblia (or Giardia intestinalis).
Parasitic helminths include nematodes (eg, hookworm, whipworm, filariid, roundworm, strongyles and trichostrongyl nematodes), such as Ancyclostoma spp., Necator spp., Brugia spp., Wuchereria spp., Loa spp., Mansonella spp., Trichinella spp., Trichuris spp., Ascaris spp., Anisakis spp., Dracunculus spp., Strongyloides spp., Haemonchus spp., Toxocara spp., Dictyocaulus spp., Ostertagia spp., Teladorsagia spp, Onchocerca spp. and Dirofilaria spp. Other examples include Acanthocheilonema spp., Aelurostrongylus spp., Angiostrongylus spp., Bunostomum spp., Dioctophyme spp., Dipetalonema spp., Lagochilascaris spp., Muellerius spp., Parafilaria spp., Parascaris spp., Protostrongylus spp., Setaria spp., Stephanofilaria spp., Strongylus spp., Thelazia spp., Capillaria spp., Chabertia spp., Cooperia spp., Enterobius spp., Nematodirus spp., Oesophagostomum spp., and Trichostrongylus spp. Other examples of helminth parasites include trematodes, such as Schistosoma spp. and liver flukes such as Fasciola spp (eg Fasciola hepatica).
Ancyclostoma spp. includes Ancylostoma duodenal, Ancylostoma ceylanicum, Ancylostoma braziliense, Ancylostoma caninum, Ancylostoma pluridentate, and Ancylostoma tubaeforme. Necator spp. includes Necator americanus. Brugia spp. includes Brugia malayi, Brugia timori and Brugia pahangi. Wuchereria spp. includesIVuchereria bancrofti. Loa spp. includes loa loa. Mansonella spp. includesMansonella streptocerca, Mansonella perstans and Mansonella ozzardi. Trichinella spp. includes Trichinella spiralis, Trichinella pseudospiralis, Trichinella nelsoni, Trichinella britovi, Trichinella murrelli, and Trichinella nativa. Trichuris spp. includes Trichuris trichiura, Trichuris matured, Trichuris campanula, Trichuris suis, Trichuris
Ovis and Trichuris vulpis. Ascaris spp. includes Ascaris lumbricoides, and Ascaris suum. Anisakis spp. includes Anisakis simplex. Dracunculus spp. includes Dracunculus medinensis, and Dracunculus insignis. Strongyloides spp. includes Strongyloides stercoralis and Strongyloides papillosus. Onchocerca spp. includes Onchocerca volvulus and Onchocerca tubingensis. Dirofilaria spp. includes Dirofilaria immitis and Dirofilaria repens. Haemonchus spp. includes Haemonchus contortus and Haemonchus placei. Toxocara spp. includes Toxocara canis and Toxocara cati. Dictyocaulus spp. includes Dictyocaulus viviparus and Dictyocaulus arnfieldi. Chabertia spp. includes Chabertia ovina. Cooperia spp. includes Cooperia curticei and Cooperia oncophora. Nematodirus spp. includes spathiger Nematodirus and Nematodirus filicollis. Oesophagostomum spp. includes Oesophagostomum columbianum and Oesophagostomum venulosum. Trichostrongylus spp. includes Trichostrongylus axei, Trichostrongylus colubriformis and Trichostrongylus vitrinus. Other parasitic nematodes include Trichosuri parastrongyloides, Ostertagia ostertagi, Ostertagia trifurcata, and Teladorsagia circumcincta.
Schistosoma spp. comprises Schistosoma mansoni, Schistosoma haematobium, Schistosoma japonicum, Schistosoma mekongi, Schistosoma bovis, Schistosoma mattheei, Schistosoma margrebowiei, Schistosoma curassoni, Schistosoma rodhaini, Schistosoma indicum, Schistosoma intercalatum, Schistosoma malayensis, Schistosoma ovuncatum, Schistosoma nasale, and Schistosoma spindale. Fasciola spp. includes Fasciola hepatica, Fasciola magna, Fasciola gigant ica, Fasciola jacksoni.
Reference 46 speculatively discloses therapeutic compositions for protecting animals from diseases caused by parasitic helminths which include parasitic helminth MI F proteins, nucleic acids which hybridize under conditions of stringency with a MIF gene Dirofilaria immitis or MIF gene Onchocerca volvulus and isolated antibodies that selectively bind to a parasitic helminth MIF protein. However, in contrast to the present invention, these therapeutic compositions are not supported by experimental evidence which establishes that such compositions would have a therapeutic effect. Nevertheless, in some embodiments of the present invention, the parasite is not a parasitic helminth. In some embodiments, the parasite is not a parasitic nematode. In some embodiments, the parasite is not a nematode filariid worm. In some embodiments, particularly wherein the composition comprises a nucleic acid comprising a sequence that encodes a parasitic MIF antigen, the parasite is not Onchocerca volvulus or Dirofilaria immitis. For example, in some embodiments the parasitic MIF antigen (e.g., the parasite-encoded MIF antigen encoded by a nucleic acid of the composition) is not a MIF antigen Onchocerca volvulus or MIF antigen Dirofilaria immitis.
Reference 47 assessed the immune response induced by DNA vaccines expressing Trichinella spiralis MCD-1, T. spiralis MIF or co-expressing T. spiralis MCD-1 and MIF, in BALB / c mice. Immunization with MCD-1 co-expressing vaccine and MIF was followed by a small reduction in parasite burden but MIF expressing T. spiralis DNA vaccine does not protect mice against T. spiralis infection . In some embodiments of the present invention, the parasite is not Trichinella spiralis, particularly wherein the composition comprises a nucleic acid (and DNA in particular) comprising a sequence that encodes a parasitic MIF antigen. In some embodiments, the parasitic MIF antigen (e.g., the parasitically encoded MIF antigen encoded by a nucleic acid of the composition) is not a MIF antigen of Trichinella spiralis. In some embodiments, the parasitic MIF composition and / or antigen does not include multicystatin analog domain protein, such as T. spiralis MCD-1.
Parasitic infections may, for example, include malaria (eg, cerebral malaria), toxoplasmosis, coccidiosis, babesiosis, theileriosis, trypanosomiasis, leishmaniasis, filariasis, elephantiasis, trichinosis, trichuriasis , ascariasis, dracunculiasis (Guinea worm disease), equine protozoan myeloencephalitis (EPM), fasciolosis and schistosomiasis. Preferably, the methods and compositions described herein are used to provide protective immunity against malaria.
The methods and compositions described herein can be used to provide protective immunity against single parasite infection, or co-infection with two or more different parasites. The two or more parasites may be two or more parasites selected from those listed here. In some embodiments, at least one of the two or more parasites is a Plasmodium parasite, such as a Plasmodium falciparum parasite.
Treatment methods and medical uses
The compositions disclosed herein may be useful in a method for providing protective immunity against parasitic infection in a subject (e.g., a vertebrate) in need, including performing administration of the composition (e.g., an effective immunological amount of the invention). composition) about. The invention also provides a composition as set forth herein for providing protective immunity against parasitic infection in a subject.
In some embodiments, the composition provides protective immunity by generating a protective immune response against parasite infection (e.g., active immunization), particularly in those embodiments where the composition comprises a nucleic acid comprising a sequence that encodes a parasitic MIF antigen or comprises a parasitic MIF antigen. Protective immunity may also be given by administration to an antibody that specifically binds to the parasitic MIF antigen (e.g., by passive immunization). Protective immunity can also be provided by administration of parasite-sensitive CD4 T cells from a compatible host (preferably of the same species as the subject), wherein the host is vaccinated with a composition of invention: that is, a composition which comprises an effective immunological sum of (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen or (ii) a parasitic MIF antigen (eg, by adoptive transfer of lymphocytes T CD4). The compatible host may have been vaccinated with the composition and exposed to the parasite or parasite antigen to produce a population of parasite-sensitive CD4 T cells. Administration of a composition of the invention to a subject (or compatible host) allows the subject (or host) to produce a CD4 T cell population of a parasite in response to exposure to the parasite or antigen of parasite. The parasite-sensitive memory CD4 T cell population can be "sterile" immunized (i.e., complete protective immunity) against reinfection.
Thus, a method is also provided herein to provide the subject with protection against parasitic reinfection (e.g., sterilization) immunity against parasite reinfection. The method may include: (i) administering a composition of the invention (e.g., a composition comprising a nucleic acid comprising a sequence that encodes a parasitic MIF antigen) thereon and (ii) subsequently infecting the subject with the parasite or vaccinating the object with another parasitic antigen (to produce a population of parasite-sensitive CD4 T cells). In step (ii), a subsequent infection of a subject with the parasite may be deliberate in a study in animals, but in humans, it is preferable that this occurs through natural infection. . Thus, the method can be applied to a subject who is likely to be exposed to the infection, for example who lives in a malarious area, or who works with patients with malaria, etc. Eventually (eg, where the subject is infected with the parasite), these methods may further include curing about infection with the parasite, for example, by administering an agent that kills or attenuates the parasite, such as described here.
The terms "protective immunity" or a "protective immune response," as used hereinafter, refer to immunity or to elicit an immune response against an infectious agent (eg parasite), which is exposed by a subject, which prevents or attenuates an infection or reduces at least one symptom thereof. More specifically, the induction of protective immunity or a protective immune response to administration of a composition of the invention is evident by the elimination or reduction of the presence of one or more symptoms of [0002] In this document, the term "immune response" refers to both the humoral immune response and the cell-mediated immune response. Preferably, the protective immunity provided by the invention is characterized by the protective immunological memory (e.g., a prototypical memory T cell response) against the parasite. Protective immunity can be characterized by a population of parasite-sensitive and efficient (e.g., Plasmodium-sensitive) memory T cells. In preferred embodiments, protective immunity is maintained (e.g. the protective effect does not decrease during infection with the parasite). Preferably, the subject can recover from the parasite infection. In preferred embodiments, treatment with a composition of the invention as described herein provides protective immunity against re-infection by the parasite. Protective immunity may be sterilizing immunity (i.e., complete protective immunity), the protected subject may cause an immune response that completely eliminates the infection.
A composition of the invention can therefore treat or prevent infection with the parasite (or a disease associated therewith). In preferred embodiments, the disease is malaria. More particularly, the disease can be cerebral malaria.
The compositions according to the invention can be used to induce a primary immune response and / or to stimulate an immune response.
When a subject is treated in accordance with the present invention, the subject may have a population of parasite-sensitive (eg, Plasmodium-sensitive) memory T cells relative to an untreated subject after the parasitic infection, particularly in the modes. wherein the composition comprises a nucleic acid comprising a sequence that encodes a parasite antigen or MIF comprises a parasitic MIF antigen. The population of parasite-sensitive memory T cells may comprise CD4 + Ki67 + IL-7Ra + T cells. For example, parasite-sensitive memory T cells may comprise T memory cells (CD4 + CD62L + Ki67 + IL- 7Ra +) and / or T effector cells (CD4 + Ki67 + CD62L-IL-7Ra +). The parasite-sensitive memory T cell population may be expanded by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least minus 40%, at least 45%, at least 50% (eg compared to an untreated subject) after a parasite infection.
When a subject is treated in accordance with the present invention, the subject may have decreased IFN-gamma levels relative to an untreated subject, following a parasite infection. For example, IFNy serum levels may be decreased. The production of IFNγ by the terminal and inflammatory effector CD4 T cells can be decreased. IFNy levels can be evaluated by specific ELISA. The decrease can be at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% compared to an untreated subject after the parasite infection.
A composition of the invention that can be administered to a subject to enable the subject to develop and / or maintain a sterilizing immunity to parasite infection. Protective immunity may be provided or increased in a subject vaccinated after parasite infection or exposure to another parasite or antigen vaccine (eg, additional parasite antigen, as defined herein).
A composition of the invention can be used in a prime-boost vaccination scheme. The protective immunity against a parasitic infection according to the invention can be achieved by administering a sensitizing vaccine, comprising a composition of the invention, followed by a booster vaccine. The booster vaccine is distinct from the starter vaccine and comprises or encodes one or more additional parasite antigens (i.e., non-MIFs) as defined herein. The booster vaccine may, for example, include an attenuated form of parasite to which protective immunity is to be provided. Preferably, the priming and booster vaccines are administered at least about 16 weeks apart (e.g., about 8 weeks, 6 weeks, 4 weeks, 2 weeks or at least 1 week apart). As an alternative, both vaccines can be administered 12 hours apart, 6 hours, 3 hours, 2 hours or 1 hour each.
If the composition of the invention comprises antibodies that specifically bind to a parasite MIF antigen (anti-parasite MIF antibody), the composition can be used in a method of treating a parasite infection or a method for providing immunity protective against parasitic infection, i.e., passive immunization for therapeutic or prophylactic purposes. For example, the composition can be used in a method of treating (eg, improving) one or more of the symptoms of malaria (i.e. where the parasite is Plasmodium). Symptoms can be selected from headaches, fever, chills, joint pain, vomiting, hemolytic anemia, yellowing, hemoglobinuria, retinal damage, seizures, encephalopathy, or one or more of the neurological symptoms , including abnormal posture, nystagmus, conjugate paralysis look (the eyes do not rotate together in the same direction), opisthotonos, seizures, or coma. Malaria can be a cerebral malaria.
In some embodiments, the anti-parasitic MIF antibody is administered to an infected subject. The subject may be a newly infected subject. For example, the antibody can be given within 2 weeks of infection (eg within 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days , 24 hours). In addition, the subject may present a risk of infection. For example, the subject may be at risk of infection within 2 weeks of the administration of the antibody (for example in 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days). days, 2 days, 24 hours).
In some embodiments, the subject is a vertebrate, for example, a mammal, such as a human or a veterinary mammal (cat, dog, horse, cow, sheep, cattle, deer, goat or pig) that the parasites referred to in may be problematic in a wide range of species.
The compositions of the invention may be formulated as vaccine compositions. The vaccines of the invention may be either prophylactic (ie, to prevent infection) or therapeutic (ie, to treat infection), but will generally be prophylactic.
The compositions of the invention can be used to treat children and adults. When the vaccine is for prophylaxis, the man is preferably a child (eg, a toddler or infant) or adolescent. When the vaccine is for therapeutic use, the man is preferably a teenager or an adult. A vaccine for children can also be given to adults, for example to evaluate safety, dosage, immunogenicity, etc.
Thus a human subject can be less than 1 year old, less than 5 years old, 1-5 years old, 5-15 years old, 15-55 years old, or at least 55 years old. Preferred patients for receiving the compositions are the elderly (eg,> 50 years,> 60 years and preferably> 65 years of age), youth (eg, <5 years old), hospitalized patients, health workers, armed and military services, pregnant women, the chronically ill or immunodeficient. However, the compositions are not suitable for these groups alone and can be used more generally in a population.
The subject may have been previously infected and / or developed an immune response against the parasite of interest. For example, the subject may have previously developed an immune response against the parasitic MIF antigen of interest. On the other hand, the subject may be immunologically naive with respect to the parasite and / or the parasitic MIF antigen.
By "immunologically effective amount" is meant that the administration of this amount to a subject, either as a single dose or as part of a series, is effective for treating or preventing a parasite infection. This quantity varies according to the health and physical condition of the individual to be treated, the age, the taxonomic group of the individual to be treated (eg human, non-human primate, etc.), the ability of the individual to the immune system of the individual to synthesize antibodies, the desired degrees of protection, the formulation of the composition or vaccine, the assessment of the physician treating the medical situation, the severity of the disease, the potency of the administered compound, the mode of administration and other relevant factors. It is expected that the amount will fall in a relatively wide range that can be determined by means of routine tests.
A dose of nucleic acid (eg, a nucleic acid based vaccine) may have <100 μg nucleic acid; for example 10-100 μg, subject 10 μg, 25 μg, 50 μg, 75 μg or 100 μg, but expression can be seen at much lower levels; for example using <1 μg / dose, <100 μg / dose, <10 μg / dose, <1 μg / dose, etc. Similarly, a dose of a protein antigen may have <100 μg of protein; for example 10-100 μg, up to about 10 μg, 25 μg, 50 μg, 75 μg or 100 μg. A dose of an antibody may have 1000 mg antibody or antibody of <500 mg; for example, from 1-1000 or 1-500 mg, such as about 10mg, 20mg, 50mg, 100mg, 200mg, 300mg, 400mg, 500mg, 600mg, 700mg, 800mg or 900mg mg. The antibody can be administered in a dose of about 0.1-10 mg / kg body weight.
The compositions of the invention will generally be administered directly to a subject. Direct delivery may be by parenteral injection (eg, subcutaneously, intraperitoneally, intravenously, intramuscularly, intradermally, or interstitial space of tissue). Other routes of delivery include rectal, oral (eg tablet, spray), oral, sublingual, vaginal, topical, transdermal or transcutaneous, intranasal, ocular, auditory, pulmonary or other mucosal administration. Intradermal and intramuscular administration are two preferred routes. Injection can be via a needle (eg a hypodermic needle), but needleless injection can also be used. A typical intramuscular dose is 0.5 ml.
One way of verifying the effectiveness of the therapeutic treatment includes monitoring parasite infection after administration of compositions described herein. One way to test the efficacy of prophylaxis is to monitor immune, systemic responses (eg, monitoring the level of IgG1 and IgG2a production) and / or mucosal responses (eg, monitoring the level of IgA production). ), against the antigen. In general, antigen-specific serum antibody responses are determined post-vaccination but prior to challenge, whereas antigen-specific mucosal antibody responses are determined post-vaccination and after challenge.
Another means of evaluating the immunogenicity of the compositions according to the invention is to express the parasitic MIF antigen by recombination for screening patient sera or mucosal secretions by immunoblotting and / or microarray. A positive reaction between the parasitic MIF antigen and the patient sample indicates that the patient has mounted an immune response to the antigen. This method can also be used to identify immunodominant antigens and / or epitopes within protein antigens. The effectiveness of the compositions can also be determined in vivo by challenging appropriate animal models of the parasite infection of interest.
The dosage may be by a single dose schedule or a multiple dosing schedule (for example two or more doses). Multiple doses may be used in a primary vaccination program and / or in a booster vaccination schedule. In a multiple dose regimen, the different doses can be given by identical or different routes, for example, parenteral priming and mucosal booster, mucosal priming and parenteral booster, etc. Multiple doses will typically be administered at least 1 week apart (eg, about 2 weeks, about 3 weeks, about 4 weeks, about 6 weeks, about 8 weeks, about 10 weeks, about 12 weeks, about 16 weeks, etc.). In one embodiment, the two or more doses are administered approximately 3 weeks apart.
When multiple doses of a composition of the invention (i.e., two or more doses) are administered to a subject, the composition used for each dose may be selected independently of a composition which comprises: ) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; (ii) a parasitic MIF antigen; and (iii) an antibody that specifically binds to a parasitic MIF antigen. The composition administered in a first dose (the first dose composition) may be a composition comprising one of (i), (ii) and / or (iii) and the composition administered in a second dose (the second dose composition) may be a composition comprising one of (i), (ii) and / or (iii). The composition of each of the two or more doses may be the same (for example a first dose of (i) followed by a second dose of (i), or a first dose (ii) followed by a second dose of ii)) or may be different (eg a first dose of (i) followed by a second dose of (ii), or a first dose of (ii) followed by a second dose of (i)). In each of (i), (ii) and (iii), in each dose, the parasitic MIF antigen may be the same parasite MIF antigen.
The invention relates to compositions comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. The composition may be a pharmaceutical composition, for example a vaccine composition. Accordingly, the composition may also comprise a pharmaceutically acceptable carrier. If the composition comprises a nucleic acid comprising a sequence that encodes a parasitic MIF antigen (e.g., nucleic acid based vaccine), the composition may also include a delivery system as described above.
A "pharmaceutically acceptable carrier" includes any carrier that does not induce the production of antibodies that are harmful to the individual receiving the composition. Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose, trehalose, lactose and the like. lipid aggregates (such as oil droplets or liposomes). Such carriers are well known to those skilled in the art. The compositions may also contain a pharmaceutically acceptable diluent, such as water, saline, glycerol, etc. In addition, auxiliary substances, such as wetting or emulsifying agents, agents, similar pH buffer substances, may be present. Sterile pyrogen-free phosphate buffered saline is a typical carrier. A thorough discussion of pharmaceutically acceptable excipients is available in ref. 48.
The pharmaceutical compositions can comprise particles in ordinary water (for example w.f.i.) or in a buffer, for example a phosphate buffer, a tris buffer, a borate buffer, a succinate buffer, a histidine buffer, or a citrate buffer. Salt buffers will generally be in the range of 5 to 20 mM.
The pharmaceutical compositions can have a pH of between 5.0 and 9.5, for example between 6.0 and 8.0.
The compositions may include sodium salts (eg sodium chloride) to provide tonicity. A concentration of 10 ± 2 mg / ml NaCl is typical for example about 9 mg / ml.
The compositions may include metal ion chelators. These can prolong the stability of the RNA by removing ions that can accelerate phosphodiester hydrolysis. Thus, a composition may comprise one or more pentetic acid EDTA, EGTA, BAPTA, etc. These chelators are generally present between 10-500 μΜ, for example 0.1 mM. A citrate salt, such as sodium citrate, may also act as a chelating agent, while also advantageously providing buffering activity.
The pharmaceutical compositions may have an osmolality of between 200 mOsm / kg and 400 mOsm / kg, for example between 240 and 360 mOsm / kg or between 290 and 310 mOsm / kg.
The pharmaceutical compositions may include one or more preservatives, such as thiomersal or 2-phenoxyethanol. Mercury-free compositions are preferred, and preservative-free vaccines can be prepared.
The pharmaceutical compositions are preferably sterile.
The pharmaceutical compositions may be non-pyrogenic containing for example <1 EU (endotoxin unit, a standard measurement) per dose and preferably <0.1 EU per dose.
The pharmaceutical compositions can be gluten free.
The pharmaceutical compositions can be prepared in unit dose form. In some embodiments, a unit dose may have a volume of between 0.1-1.0 ml, for example about 0.5 ml.
The compositions can be prepared in the form of injectable compositions, either in the form of solutions or suspensions. The composition may be prepared for pulmonary administration, for example by an inhaler, using a fine spray. The composition may be prepared for nasal, auditory or ocular administration, for example as a spray or drops. Injectables for intramuscular administration are typical. The invention also provides a delivery device (e.g., a syringe, nebulizer, agricultural sprayer, inhaler, dermal patch, etc.) containing a pharmaceutical composition of the invention. This device can be used to administer the composition to a subject (e.g., a vertebrate subject).
A composition of the invention may also comprise, or be administered in combination with, one or more adjuvants (e.g., vaccine adjuvants), particularly when the composition comprises an immunologically effective amount of a parasitic MIF antigen.
Adjuvants that can be used in the compositions of the invention include, but are not limited to: (A) compositions, for example aluminum and calcium salts, such as aluminum-containing aluminum phosphates. (B) petroleum emulsions, for example squalene-in-water, such as MF59 or AS03. Freund's Complete Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA) can also be used. (C) Saponin formulations. (D) Virosomes and virus-like particles (VLPs). (E) Bacterial or microbial derivatives such as non-toxic enterobacterial lipopolysaccharide (LPS) derivatives, lipid A derivatives, immunostimulatory oligonucleotides and toxins and their ADP-ribosylating detoxified derivatives. (F) Human immunomodulators, para. examples of cytokines, such as interleukins, interferons, macrophage colony stimulating factor and tumor necrosis factor. (G) Bioadhesives and mucoadhesives such as interesterified hyaluronic acid microspheres, crosslinked poly (acrylic acid) derivatives, polyvinyl alcohol, polyvinylpyrrolidone, polysaccharides and carboxymethylcellulose. (H) Microparticles, for example particles of ~ 100 μm to ~ 150 μm in diameter, preferably ~ 200 μm to ~ 30 μm in diameter, and preferably between ~ 500 μm to ~ 10 μm in diameter) formed from of materials which are biodegradable and non-toxic (for example, a poly (α-hydroxy acid), a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a polycaprolactone, etc.), with a poly (lactide-co-glycolide) are preferred, optionally treated to have a negative charge surface (e.g. with SDS) or a positively charged surface (e.g. with a cationic detergent, such as CTAB). (I) Liposomes. (J) Formulations of polyoxyethylene ether and polyoxyethylene ester. (K) Polyphosphazene (PCPP). (L) Muramyl peptides. (M) Imidazoquinolone compounds, for example Imiquamod and its counterparts. The use of aluminum hydroxide or aluminum phosphate adjuvant is particularly preferred and the antigens are generally adsorbed to these salts. Alternatively, MF59, AS01 or AS03 can be used as an adjuvant.
Examples of adjuvants also include human TLR7 agonists, for example a compound of formula (K). These agonists are discussed in detail in reference 49:
wherein: R1 is H, C1-C6alkyl, -C (R5) 2OH, -I / R5, -I4R6, -L2R5, -L2R6, -OL2R5, or -OL2R6; L1 is -C (O) - or -O-; L2 is C1-C6alkylene, C2-C6alkylene, arylene, heteroarylene or - ((CR4R4) pO) q (CH2) p-, wherein C1-C6alkylene and C2-C6alkenylene of L2 are optionally substituted with 1 to 4 fluoro groups; each L3 is independently selected from C1-C6alkylene and - ((CR4R4) pO) q (CH2) p-, wherein C1-C6alkylene of L3 is optionally substituted with 1 to 4 fluoro groups; L4 is arylene or heteroarylene; R2 is H or C1-C6alkyl; R3 is selected from C1-C4alkyl, -L3R5, -L1R5, -L3R7, L3L4L3R7, -l3l4r5, -l3l4l3r5, -OL3R5, -OL3R7, -OL3L4R7, -OL3L4L3R7, -OR8, -OL3L4R5, -OL3L4L3R5 and -C (R5 ) 2OH; each R4 is independently selected from H and fluoro; R5 is -P (O) (OR9) 2, R6 is -CF2P (O) (OR9) 2 or -C (O) OR10; R7 is -CF2P (O) (OR9) 2 or -C (O) OR10; R8 is H or C1-C4alkyl; each R9 is independently selected from H and C1-C6alkyl; R10 is H or C1-C4alkyl; each p is independently selected from 1, 2, 3, 4, 5 and 6, and q is 1, 2, 3 or 4.
A TLR7 agonist, for example a TLR7 agonist of formula (K), may be adsorbed on an insoluble aluminum salt (for example, to form an absorbed complex for adjuvant immunogens). Useful aluminum salts include, but are not limited to, aluminum hydroxide and aluminum phosphate adjuvants. Aluminum salts that include hydroxide ions are preferred for use with the invention since these hydroxide ions can readily undergo ligand exchange with compounds of formula (K). Thus, the preferred salts for the adsorption of TLR agonists are aluminum hydroxide and / or aluminum hydroxyphosphate. These have surface hydroxyl groups that can easily be ligand-exchanged with phosphorus-containing groups (eg, phosphates, phosphonates) to provide stable adsorption. In an exemplary embodiment, an aluminum hydroxide builder is used. Alternatively, a TLR7 agonist, such as a TLR7 agonist of formula (K) can not be adsorbed to an insoluble aluminum salt.
Phosphorus-containing adjuvants used with the present invention may exist in a number of protonated and deprotonated forms depending on the pH of the surrounding medium, for example the pH of the solvent in which they are dissolved. Therefore, even if a particular shape can be illustrated, it is intended that these illustrations are merely representative and not limiting to a specific protonated or deprotonated form. For example, in the case of a phosphate group, this has been illustrated as -OP (O) (OH) 2 but the definition includes the protonated forms [0P (0) (0H2) (0H)] + and - [OP (0) (OH) 2] 2+ that may exist under acidic conditions and deprotonated forms - [OP (O) (OH) (O)] 'and [OP (O) (O) 2] 2' that may exist in basic conditions.
Combinations of one or more adjuvants identified above may also be used with the invention. Sequence Identity Sequence identity or homology is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the amino acid reference sequence after alignment of the sequences and introducing gaps, if necessary, to achieve the maximum percentage of sequence identity without taking into consideration any conservative substitution as part of the sequence identity. Sequence identity can be determined by standard methods that are commonly used to compare the amino acid position similarity of the two polypeptides. Using a computer program such as BLAST or FASTA, two polypeptides are aligned for optimal matching of their respective amino acids (either along the entire length of one or two sequences or along a predetermined portion of one or both sequences). The programs offer a default opening penalty and a default gap penalty and a scoring matrix such as PAM 250 [a standard scoring matrix. See Dayhoff et al., Atlas of Protein Sequence and Structure, vol. 5, supp. 3 (1978)] can be used in conjunction with the computer program. For example, the percentage identity can be calculated as follows: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longest sequence in the corresponding interval and the number of gaps introduced in shorter sequences to align the two sequences. General
The term "comprising" includes "including" as well as "compound" for example a composition "comprising" X may consist exclusively of X or may include something additional, for example X + Y.
The term "about" in relation to a numerical value x is optional and means, for example, x + 10%.
When the present invention refers to a reference sequence to a UniProt or GenBank membership code, the target sequence is the current version at the filing date of this application.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 shows malaria-specific T cell responses in mice immunized with: RNA encoding PbMIF in a delivery vehicle CNE (PbMIF-CNE); RNA encoding GFP in a delivery vehicle CNE (GFP-CNE); or mice immunized with PbMIF protein with Freund's adjuvant (PbMIF-FA); at 7 days after Plasmodium infection at day 40 post-vaccination. * P <0.05
Figure 2 shows the neutralization activity of PbMIF vaccination on (A) Plasmodium parasitaemia and (B) spleen parasite content at 7 days post-infection. * P <0.05
Figure 3 shows serum anti-PbMIF titers (OD 2 onm) at day 14 (2 weeks after the first immunization) for mice immunized with CIE / PMIF RNA / GFP / CNE. Average securities are expressed as endpoint securities; the reciprocal dilution which is given in full OD45onni · **** PC0,0001 Mann-Whitney U, n = 15 per group.
Figure 4 illustrates serum anti-PbMIF (OD450nm) titers at day 35 (2 weeks after the second immunization) for mice immunized with RNA / PMIF CNE or RNA / GFP CNE. Titers are averaged in Figure 3. **** P <0.0001 Mann-Whitney U, n = 15 per group.
Figure 5 shows: (A) an RNA / PbMIF CNE and RNA / GFP CNE vaccination system, first challenge of parasite, cure (CQ) and second challenge of the parasite; (B) Plasmodium parasitaemia beyond 7 days after the first parasite challenge (days 35 to 42); and (C) IFNy serum levels over 5 days · post infection. * P <0.5, ** P <0.01 Mann-Whitney U, n = 15 per group.
Figure 6A shows serum anti-PbMIF titers (OD450nm) at day 59 (2.5 weeks post-infection) of mice immunized with RNA / PMIF CNE or RNA / GFP CNE (**** P < 0.0001 ü from Mann-Whitney, n = 15 per group). Figure 6B shows the mean responses of anti-Plasmodium IgG at day 59 (*** p <0.01 U Mann-Whitney, n = 15 per group). Titles are averaged in Figure 3.
Figure 7 shows parasitaemia of Plasmodium in mice immunized with RNA / PMIF CNE or RNA / GFP CNE for 14 days after the second challenge (59-73 days). * P <0.05, ** P <0.01 Mann-Whitney U, n = 9 in total (4 x RNA / GFP control CNE, 5 X RNA / PMIF CNE).
Figure 8 shows the effects of RNA / PMIF CNE compared to RNA / GFP CNE vaccination on T-cell phenotype. T cells responding to P. berghei (CD4 + Ki67hi) were divided into subsets: Tmem ( memory) CD62L + IL-7Ra +;
Tem (effector memory) CD62L IL-7Ra +; and eff (effector) CD62L-IL-7ROT. Figure 8A shows the percentages of different T cell phenotypes, 7 after primary infection. Figure 8B shows the percentages of the different T cell phenotypes, 7 days after the second infection. Figure 8C shows the percentages of cells that are PD-1 + (indicating the depletion of T cells). * P <0.05, ** P <0.01 Mann-Whitney U.
Figure 9 shows Plasmodium parasitaemia in mice receiving passive transfer of anti-PbMIF (IgG) polyclonal antibody compared to mice that received non-immunized rabbit control IgG (Ctrl IgG) on postinfection day 7. Each data point represents a single mouse. P = 0.0005 per t-test.
Figure 10 shows that passive IgG transfer from immunized PbMIF mice and infected blood stage provides partial protection for both C57BL / 6 sensitive BALB / c and cerebral malaria. (A) 1 / IgG isolated from GFP (control) or PbMIF vaccinated and infected PbA mice were i.p. administered to naive BALB / c and C57BL / 6 mice followed by PbA infection. (B) Parasitaemia and Kaplan-Meyer Survival Analysis of BALB / c Mice Administered Immune IgG. The p values were generated using a long-range test and the data are from two independent experiments with 5 mice per group (* p <0.05, ** p <0.01). (C) Kaplan-Meyer survival plots and ECM (experimental neuropaludism) of C57BL / 6 mice administered immune IgG and infected with PbA. Statistical p values were generated using a long-range test (** p <0.01) and the data are representative of the two independent experiments n = 10 mice per group.
Figure 11 shows that adoptively transferred CD4 T cells of a PbMIF immunized mouse confer protection to homologous challenge. (A) CD45.2 BALB / c immunized mice were infected with 106 PbA-iRBCs and treated with chloroquine on days 7-12. Four weeks later, the mice were re-infected with PbA and splenocytes isolated at day 7 post infection, incubated with chloroquine to remove Plasmodium residues and labeled with CFSE. The purified CD4 T cells (2 x 107) were therefore transferred into naive and infected BALB / c CD45.1 mice 3 days later with 106 PbA-iRBCs. (B) Parasitaemia in mice by adoptive transfer of CD4 T cells from GFP (o) or PbMIF (·) from immunized mice (* p <0.05, #p <0.001, by two-way ANOVA analysis) . The graph shows% parasitaemia compared to post-infection days. (C) The typical CFSE dilution histogram of adoptively transferred CD4 T-cells (CD45.2) from GFP or immunized donors of PbMIF, the enumeration of recovered CD45-transferred CD4 T cells, and the response of the proliferation of CD4 T cells transferred to CD45.1 vessels 7 days after infection. (D) Percentage of proliferation of CD45.2 CD4 T cells (CFSE10) producing IFNy after ex vivo stimulation with PbA-iRBC lysates. (E) Mean fluorescence intensity of PD-1 in GFP CD4.2 CD45.2 PjbA-sensitive (CFSE10) T cells (control) or immunized donors of PbMIF. The results are from two separate experiments with 4 mice per group (* p <0.05, ** p <0.01 per Mann-Mann test).
Whitney.)
EMBODIMENTS OF THE INVENTION
EXAMPLE 1: VACCINATION USING P. EERGHEI MIF, FOLLOWED BY THE PARASITE CHALLENGE
Groups of 5 female BALB / c mice 8-10 weeks old were immunized with: (1) P-coding RNA.
berghei MIF (PbMIF) in a LNP delivery vehicle (RV01, see references 34 and 36); (2) an RNA coding for PbMIF
in a CNE delivery vehicle (including squalene and DOTAP, as described in reference 35); (3) RNA encoding GFP in a delivery vehicle CNE; or (4) by intraperitoneal (i.p.) injection of PbMIF protein with Freund's adjuvant as shown in Table 1. Immunizations were performed on days 0 and 21.
Table 1
Blood samples were taken from immunized mice at day 14 and day 35 (14 days post-boost) and total serum IgG titres against PbMIF were measured by anti-PbMIF ELISA. Immunized mice were challenged on day 38-40 by i.p. P. berghei ANKA 106 (PbA) -infected by red blood cells (red blood cells). The weight of the mice over time (days 0 to 40) and the clinical appearance were also evaluated for the mice in each experimental group.
IgG anti-PbMIF serum titres from immunized mice and vaccine tolerance
IgG titers were measured 14 days after the first immunization and 14 days after the second booster immunization. Anti-PbMIF ELISA tests were performed as follows: 96 wells were coated overnight with 100 ng / ml of PbMIF recombinant. After blocking for 1 hour at room temperature, serial dilutions of sera were incubated for 2 hours and total bound IgG was detected with rabbit anti-mouse IgG antibody coupled to horseradish peroxidase (HRP). . 3,3 ', 5,5'-tetramethylbenzidine (TMB) was used as the substrate. The reaction was stopped with the acid and OD read at 450 nm. Immunization with the self-replicating PbMIF vaccine of RNA or PbMIF protein (Groups 1, 2 and 4) elicited primary and secondary humoral antibody responses to PbMIF. No significant response was observed in control mice treated with RNA / GFP CNE (Group 3). Side reactions were observed in 80% of mice treated with RNA CNE / PMI F (group 2) and 60% of mice treated with RNA / PMIF LNP (group 1), with comparable titers. Primary responses in groups 1 and 2 were ~ 100-fold less and side reactions in groups 1 and 2 were ~ 1000-fold less than mice treated with PMIF FCA / FIA protein (group 4).
Mice tolerated vaccination well, with no change in clinical appearance (clinical observation q3d) and no reduction in weight between the different experimental groups from day 0 to day 40.
Impact of PbMIF vaccination on malaria-specific T cell responses
Groups 2, 3 and 4 were selected for the study.
Immunized mice were challenged at day 40 by i.p. of RBC red cells RBC infected with PbA. At post-infection day 7, splenocytes were isolated and stimulated ex vivo by culturing with lysates of infected red cell cells in the presence of anti-CD3 / CD28 beads and brefeldin A for 6 hours. Intracellular cytokine staining was then performed. The following antibodies were used to study IFN-γ production CD4 T cells, T cell activation (CD11a) and T-cell differentiation (T-bet): Ki67 FITC, CD45.2
PerCP-Cy5.5, IFNy PE-Cy7, CD4 Alexa 700, CDlla eFluor 405, T-bet Alexa 647 (Life Technologies). PbA-sensitive CD4 T cells are defined as CD45.2 +, KI67 +, CD4 +. The stained cells were analyzed by flow cytometry.
At day 7 post infection, immunized PbMIF mice (Groups 2 and 4) showed stronger proliferative T cell in response to P. berghei parasites (higher CD4 + KÎ67 + cells) a memory response of CD4 plus T cells strong for parasites, as indicated by CD11a lower and lower T-bet (Figs IA and IB) and less inflammatory T cells, the end effector of IFN-gamma producing (Fig. IC and 1D) that the control mice (group 3).
For example, flow cytometry showed that 5.26% of splenic CD4 T cells from the RNA / PMIF CNE (Group 2) immunized mice were inflammatory, the end effector of IFN-γ- production of CD4 T cells (labeled with antiCD4 and stained for IFN-γ to an anti-IFN-γ antibody), compared with 11.1% of splenic CD4 T cells of t.émoin / GFP CNE (Group 3) (mice immunized with cells grouped into 5 mice per group). Other studies have shown an increase> 65% in the number of Plasmodium-sensitive memory CD4 T cells (CD62L + IL7Ra +) and CD4 memory-effector CD4 T precursors (CD62L-IL7Ra +), as well as a reduction in 20% in expression of the PD-1 depletion marker in PbMIF-CNE immunized mice compared to GFP-CNE control mice at day 7 post-infection (n = 5 per group, based on two separate experiments), suggesting a relative preservation of the memory response in PbMIF immunized mice compared to the control group. It was also demonstrated that, at day 7 post-infection, the number of Plasmodium-sensitive and follicular follicular CD4 T cells (FH T-CD49dhlCDllahlCXCR5hi CD4 cells) was 50% higher in PbMIF-CNE immunized mice compared to control mice. GFP-CNE. Consistent with this increase in the observed TFH cell population, there was a corresponding improvement in the number of splenic B cells, with a 30% increase in B cells (CD19 + B220 +) and the B-cell plasmablast population more than doubled (CD19loB220loCD138hlIgD "). Thus, the PbMIF immunization is associated with an improvement of the TFH host and the B cell responses. Evaluation of the neutralization activity of PbMIF RNA vaccinations on P. berghei parasitaemia and on the splenic parasite content
At day 7 post-infection, parasitaemia was also studied in challenged group 2 and 3 immunized mice. Parasitic burden was measured by quantitative PCR detection of peripheral blood P. berghei 18S rRNA copies, and the splenic parasite burden was measured by the expression of 18S rRNA relative to the GAPDH host.
As shown in fig. 2, a PbMIF-CNE vaccination was associated with a significant reduction in parasitaemia (30%) and splenic parasite content in the challenge with P. berghei infection.
Parasitaemia and survival during the first infection
In another experiment, BALB / c mice previously vaccinated with the RNA / PbMIF-CNE or GFP-CNE vaccine were infected with PbA and parasitemia followed by FACS. Parasitaemia was significantly reduced in immunized RNA / PbMIF-CNE mice compared to GFP-CNE-immunized control mice. While there was no initial difference in parasitaemia between the two groups, there was a faster increase in parasitaemia after day 5 in the control group (GFP-CNE), which became moribund at day 21 In contrast, immunized PbMIF mice showed better control of parasitaemia during the first 15 days of infection. Survival was also monitored up to 30 days postinfection and RNA / PbMIF-CNE-immunized mice showed a 37% prolongation in mean survival time compared to immunized GFP-CNE control mice.
Conclusions (1)
PbMIF protein and self-replicating RNA vaccines are well tolerated and produce a primary and secondary humoral antibody response in BALB / c mice.
Immunization of RNA / PbMIF (with CNE) neutralized the Plasmodium PbMIF activity, and improved the differentiation of memory CD4 T cells. In addition, neutralization of PbMIF activity significantly reduced the parasitaemia and parasite content of the spleens and undoubtedly improved the average survival time in the infected mice. Thus, the PbMIF vaccination confers at least partial protection to the first challenge of infection.
EXAMPLE 2: VACCINATION USING P. BERGHEI MIF IN A
DELIVERY VEHICLE CNE RNA, MONITORING CHALLENGE, HEALING AND PARASITE REDIEF Example 2 differs from Example 1 in the addition of a first parasite challenge, followed by healing to expand the memory T cell population specific to Plasmodium.
Groups of 15 female BALB / c mice 8-10 weeks old were immunized with: (1) RNA encoding PbMIF in a CNE delivery vehicle and (2) RNA encoding GFP in a CNE delivery vehicle as shown in Table 2. Immunizations were performed on days 0 and 21.
Table 2
Blood samples were taken from immunized mice on days 14 and 35 and complete serum anti-PbMIF IgG titers were measured by anti-PbMIF ELISA. Immunized mice were challenged at day 35 by i.p. of infected 106PbA red blood cells. It was followed by healing with chloroquine (CQ) (50 mg / kg / day) on days 7-10 post-challenge (days 42-45).
Readings following the first challenge:
Parasitaemia: 3, 5 and 7 days post-challenge (days 38, 40, 42).
Anti-Ig total serum PbMIF and total anti-Plasmodium Ig after CQ healing (before the 2nd challenge, day 59).
The immunized mice were re-challenged with P.berghei at day 59 and the infection was followed for 7 or 14 days post-challenge. 5 mice / group were euthanized at day 4 or 7 and the remaining mice were monitored for parasitaemia.
Readings:
Parasitaemia: days 5, 8, 11 and 14 post-challenge (days 64, 67, 70, 73).
T cell phenotypes (day 66).
Serum PbMIF anti-IgG titres at day 14 (two weeks after the first vaccination) and at day 35 (two weeks after the second vaccination)
Serum IgG titers were measured by anti-PbMIF ELISA at day 14 after the first immunization and at day 35 after the second immunization. Anti-PbMIF ELISA assays were performed as in Example 1.
Serum anti-IgG PbMIF titres were measured for each mouse at day 14. An anti-IgG response
PbMIF (~ 1/2 500) was observed in 50% of PbMIF immunized mice in group 1 after the first immunization. Titles averaging 14 days are shown in the figure. 3.
In addition, PbMIF serum anti-IgG titers were measured for each mouse on day 35. An increase in anti-PbMIF IgG titers was observed in 95% of PbMIF immunized mice in group 1 after the second immunization in the PbMIF-CNE group and titers are 5 times higher compared to those at day 14 (~ 1 / 14,500).
Day 35-42 Challenge Infection to Extend Plasmodium-Specified Memory T Cells
Parasitaemia was evaluated on days 3, 5 and 7 after the first challenge (days 35-42), as described in Example 1. The IFNy serum was also evaluated by a specific ELISA at day 5 post-infection.
As shown in fig. 5B, a detectable difference (0.5 log) of parasitaemia was observed 7 days after the first Plasmodium infection. This effect is associated with reduced IFNy circulation that is consistent with reduced levels of a highly inflammatory T cell IFNy + T response (Fig. 5C).
Serum anti-PbMIF and anti-Plasmodixm IgG titres at day 59, 2.5 weeks after the first infection
Serum PbMIF anti-IgG antibody titers were measured for each mouse at day 59. Plasmodium infection increased anti-Ig PbMIF antibody titers by 10-fold (Fig. 6A) in RNA / PbMIF compared to RNA / GFP mice. In addition, anti-Plasmodium IgG serum titres were measured at day 59 by anti-mouse IgG ELISA on parasitized red blood cell lysates. Plasmodium infection increased anti-Plasmodium Ig titers by 5-fold (Fig. 6B) in RNA / PbMIF compared to RNA / GFP mice.
Parasitaemia following the new challenge with Plasmodium on day 59
Parasitaemia was assessed on days 5, 8, 11 and 14 after the second challenge (days 59-73) as described in Example 1.
As shown in FIG. 7, RNA / PbMIF vaccination markedly reduced parasitaemia (5 log at day 14 postinfection) after the re-challenge of Plasmodium at day 59. Evaluation of the effects of ΆΚΝ / PbMIF on Plasmodium-specific T cell phenotype
The mice were euthanized at day 7 after the second infection and the T cell response and phenotype were analyzed with cytokine production. Spleen cells were isolated on 4-5 mice per experimental group and analyzed for CD62L and IL-7Ra staining. CD62L and IL-7Ra identify the different subsets of T cells responding to P. berghei (CD4 + Ki67hl). The results are summarized in Table 3.
Table 3
Thus, the PbMIF neutralization increases the reservoir of memory CD4 + T cells responding to P. berghei-.
Impact of RNA / PbMIF vaccine on Plasmodium-specific T cells
T cell phenotypes observed after the first Plasmodium infection (post-infection day 7, study data in Example 1) (Fig. 8A) were compared to T cell phenotypes observed after second Plasmodium infection ( day 7) (Fig. 8B).
As can be seen in FIGS. 8A and 8B, the RNA / PbMIF-CNE vaccine promotes the development of Plasmodium-specific Tmem cells (CD62L + IL-7Ra +) during a first P. berghei infection and these Tmem cells increase again during the second infection.
In addition, T cell depletion, as indicated by Plasmodium-specific Tmen cells expressing PD-1, was reduced in RNA / PbMIF immunized mice compared to RNA / GFP immunized mice (Fig. 8C).
T-cell cytokine production by Plasmodium-sensitive T cell subsets
IFNγ production by Tem (short-acting effector memory cells) is reduced in animals immunized with PbMIF. This may reflect a less inflammatory (and more effective) Plasmodium-specific T cell response. No obvious changes in T cells producing TNF were noted. (Data not shown)
Conclusions (2)
RNA self-replication vaccines are well tolerated and produce strong humoral responses to Plasmodium MIF (PbMIF). The first and second vaccinations induced a response in 50% and 95% of the immunized mice, respectively, with a much higher titre after the second vaccination and again after PbA infection.
Immunization of RNA / PbMIF (CNE) neutralized Plasmodium's PbMIF activity, as evidenced by improved differentiation of CD4 T cell memory. The effects of this neutralization are:
More Stephane cells and a stronger humoral anti-Plasmodium antibody response. After the main challenge with P. berghei, there is a measurable and significant decrease in parasitaemia (0.5 log).
The new challenge after healing from the first infection results in a further expansion of Tmen numbers and a significant reduction in parasitaemia (5 log).
RNA / PbMIF vaccination allows the development of memory T cells and provides significant protection against the re-challenge of malaria. RNA / PbMIF may be a viable vaccine candidate, either independently or in combination with other candidate Plasmodium vaccines, to promote long-lasting memory T-cell responses. EXAMPLE 3: PASSIVE TRANSFER OF A POLYCLONAL ANTIBODY ANTI-PBMIF
IgG was purified from a rabbit immunized with recombinant PbMIF (Anti-PbMIF IgG) or unvaccinated rabbit (Ctrl IgG) and 200 μg by intraperitoneal injection into C57BL / 6 mice at -6 hours, 24 hours, 48 hours. hours and 72 hours after infection with parasitized red blood cells of 1 x 106 P. berghei. Parasitaemia was enumerated by quantitative blood PCR at day 7 post-infection.
As shown in Figure 9, passive transfer of anti-PbMIF antibody significantly reduced parasitaemia in the mouse model of P. berghei malaria.
In another study, 200 μg of serum IgG purified by chromatography of GFP-protein (Pierce) (control) or PbMIF-immunized and PbA-infected mice was administered i.p. naive BALB / c or C57BL / 6 mice (dependent on cerebral malaria) and followed by PbA infection (Fig. 10a). An i.p. was performed on days -1, 1, 2 and 3 post-infection. In C57BL / 6 mice, cerebral malaria was monitored and symptoms classified by rapid murine Coma and behavioral scale (50), where 16 = no signs, 15-11 = mild symptomatic, 10-08 = prodromal signs of Experimental Cerebral Malaria (ECM), 07-04 = ECM. The agonic mice were immediately sacrificed. Administration of IgG from PbMIF immunized mice in BALB / c naive mice that have been infected with PbA provides partial protection, with a delayed rise in parasitaemia, a .30% reduction in parasitaemia peak, and 30% prolongation of survival time (Fig. 10B) When studied in the C57BL / 6 acute mortality model of cerebral malaria, GFP IgG (control) from immunized mice did not show protection: all mice developed neurological signs and became moribund between 6-7 days post-infection (Fig. 10C). In contrast, in C57BL / 6 mice that received IgG from PbMIF immunized mice, then were infected with PbA, there was a marked delay in developing a neurological disease, less severe disease, and a 30% rate survival, with complete protection of neurological manifestations. Cerebral malaria is a consistently fatal complication of PbA infection in C57BL / 6 mice and the protective effect of immunoglobulin occurs despite equivalent parasitaemia between groups up to the lethal moment (day 6), after which surviving mice removed from their parasites (data not shown).
EXAMPLE 4: PROTECTIVE EFFECT OF CD4 T CELLS IN VACCINATED MOUSE
BALB / c (CD45.2 +) mice vaccinated with RNA / PbMIF-CNE or with the RNA / GFP-CNE vaccine were infected by intraperitoneal injection of 106 RBC RBCs infected with PbA on day 0 and treated with chloroquine. days 7-10. Four weeks before the infected mice were reinfected and on day 7 post-infection splenocytes were isolated and CD4 T cells were incubated with 10 mM chloroquine for 2 h at 37 ° C and CFSE labeled. 5x10 6 CD4 T cells (CD45.2 +) were then i.v. transferred into CD45.1 BALB / c naive mice. All CD45.1 mice were infected with PbA (1 x 106 iRBCs) on posttransference day 3 (Fig. 11a). The course of infection in mice transferred with CD4 T cells from RNA / GFP-CNE or RNA / PMIF-CNE donors was followed by the determination of FACS parasitaemia. At day 7 after infection, the mice were euthanized and the donor cells CD4 + CD45. 2 + recovered, quantified, and their proliferation evaluated by CFSE dilution. Infection was established in recipient mice that received CD4 T cells in the GFP (control) group, as evidenced by parasitaemia increase, but not in mice that received PbMIF CD4 T cells from immunized donors (Fig. 11B).
Parasitaemia was significantly reduced in mice transferred with CD4 T cells from RNA / PMIF-CNE-vaccinated donors compared to control mice transferred with CD4 T cells from GFP-CNE-immunized donors. Thus, adoptive transfer of CD4 T cells from vaccinated mice PMIF also conferred protection against parasite re-challenge. In fact, immunized mouse CD4 PbMIF T cells confer complete protection against P. berghei infection at the blood stage.
The protection afforded by adoptive transfer of CD4 T cells from immunized donors PbMIF was associated with a higher number of CD4 T cell proliferation (CFSE10) (Fig. 11C), higher levels of IFN- γ (Fig. 11D), and reduced the expression of depletion marker PD-1 (Fig. 11E) relative to CD4 T cells by adoptive transfer in the control group.
These data indicate that the increased CD4 T cell response that develops after immunization in PbMIF-infected mice provides complete protection against infection and is sufficient to prevent establishment of a blood-stage infection.
It will be understood that the invention has been described by way of example only and modifications may be made while remaining within the scope and spirit of the invention.
REFERENCES
[1] Doolan et al., Clin Microbiol Rev, 2009; 22 (1): 13-36 [2] Yazdanbakhsh &amp; Sacks 2010 Nat Rev lmmunol, 10 (2): 80-81 [3] Vermeire et al. 2008 Trends Parasitol. ; 24 (8): 355-63 [4] Dobson et al. 2009 Protein Sei. 18 (12): 2578-91 [5] Sun et al. 20 2 PNAS3 ; 109 (31): E2117-26 [6] Leng et al. 2003 JExp Med 197: 1467-1476 [7] Kamir et al. 2008 J Immunol. ; 180 (12): 8250-61 [8] Cho et al. (2011) Chem Biol. ·, 18 (9): 1089-1101.
[9] Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual.
[10] Short protocols in molecular biology (4th ed., 1999) eds. Ausubel et al. ISBN 0-471-32938-X.
[11] US Patent 5,707,829 [12] Current Protocols in Molecular Biology (F.M. Eds Ausubel et al., 1987) Supplement 30.
[13] Geysen et al. (1984) PNAS USA 81: 3998-4002.
[14] Carter (1994) Methods Mol Biol 36: 207-23.
[15] Jameson, BA et al. 1988, CABIOS 4 (1): 181-186.
[16] Raddrizzani &amp; Hammer (2000) Brief Bioinform 1 (2): 179-89.
[17] De Lalla et al. (1999) J. Immunol. 163: 1725-1729.
[18] Brusic et al. (1998) Bioinformatics 14 (2): 121-30 [19] Meister et al. (1995) Vaccine 13 (6): 581-91.
[20] Roberts et al. (1996) AIDS Res Hum Retroviruses 12 (7): 593-610.
[21] Maksyutov &amp; Zagrebelnaya (1993) Comput Appl Biosci 9 (3): 291-7.
[22] Feller &amp; de la Cruz (1991) Nature 349 (6311): 720-1.
[23] Hopp (1993) Peptide Research 6: 183-190.
[24] Welling et al. (1985) FEBSLett. 188: 215-218.
[25] Davenport et al. (1995) Immunogenetics 42: 392-297.
[26] US Patent 5928902.
[27] WO 90/01496.
[28] Bodanszky (1993) Principles of Peptide Synthesis (ISBN: 0387564314).
[29] Fields et al. (1997) Meth Enzymol 289: Solid-Phase Peptide Synthesis. ISBN: 0121821900.
[30] Chan &amp; White (2000) Fmoc Solid Phase Peptide Synthesis. ISBN: 0199637245.
[31] Kullmann (1987) Enzymatic Peptide Synthesis. ISBN: 0849368413.
[32] Ibba (1996) Biotechnol Genet Eng Rev 13: 197-216.
[33] WO2005 / 113782.
[34] WO2012 / 006376 [35] WO2012 / 006380 [36] Geall et al. (2012) PNAS USA. Sep 4; 109 (36): 14604-9 [37] WO2013 / 006834.
[38] WO2013 / 006837.
[39] WO2012 / 030901.
[40] WO2012 / 031046.
[41] W02012 / 031043.
[42] WO2013 / 033563.
[43] W02013 / 006825.
[44] Breedveld (2000) Lancet 355 (9205): 735-740.
[45] Gorman &amp; Clark (1990) Semin. Immunol. 2: 457-466.
[46] WO97 / 18229 [47] Tang et al. (2012) JHelminthol.; 86 (4): 430-9.
[481 Gennaro (2000) Reminston: The Science and Practice of Pharmacy. 20th edition, ISBN: 0683306472.
[49] WO2011 / 027222.
[50] Carroll et al., (2010) PLoS ONE 5, el3124. The invention comprises at least the following numbered embodiments: 1. A method for providing protective immunity against parasitic infection in a subject in need, comprising administering an effective immunological amount of a composition to the subject, wherein the composition comprises: (i) a nucleic acid comprising a sequence that encodes an inhibitory factor antigen (MIF) for macrophage migration; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. 2. A method according to embodiment 1 wherein the composition comprises an RNA-based vaccine. 3. A method according to embodiment 1 or 2 wherein the protective immunity is characterized by immune memory protecting against the parasite and / or a population of parasite-sensitive memory T cells. 4. A method according to one of the preceding embodiments wherein the parasitic MIF antigen comprises a full-length MIF polypeptide or an immunogenic fragment thereof. 5. The method of any of embodiments 1 and 3, wherein the composition comprises a nucleic acid vaccine comprising nucleic acid that encodes a parasitic MIF antigen. 6. The method according to embodiment 5 wherein the nucleic acid vaccine is an RNA-based vaccine. The method of embodiment 6 wherein the nucleic acid vaccine comprises a self-replicative RNA molecule. 8. The method of embodiment 7 wherein the self-replicating RNA is an alphavirus-derived RNA replicon. 9. The method according to one of the preceding embodiments wherein the composition comprises a cationic nanoemulsion delivery system (CNE). The method according to one of the embodiments 1 to 8, wherein the composition comprises a nanoparticle delivery system (LNP) of lipids. 11. The method according to one of the preceding embodiments, wherein the composition comprises one or more adjuvants. The method according to embodiment 1, 3 or 4 wherein the antibody that specifically binds to a parasitic MIF antigen comprises a polyclonal antibody. The method according to embodiment 1, 3 or 4 wherein the antibody that specifically binds to a parasitic MIF antigen is a humanized or chimeric antibody. 14. The method according to any one of the preceding embodiments wherein the parasite is a protozoan parasite. 15. The method according to embodiment 14 wherein the protozoan is an apicomplex parasite. 16. The method according to the embodiment wherein the protozoan belongs to the genus Plasmodium. 17. The method according to embodiment 14 wherein the protozoan belongs to a genus selected from the group consisting of: Plasmodium, Toxoplasma, Babesia,
Eimeria, Theileria, Neospora, Sarcocystis, Leishmania, and Trypanosoma. 18. The method according to one of the embodiments 1 to 13 wherein the parasite is a parasitic helminth. 19. The method according to embodiment 18 wherein the parasitic helminth is a nematode. 20. The method according to embodiment 18 or 19 wherein the parasitic helminth belongs to a genus selected from the group consisting of: Ancyclostoma, Necator, Brugia,
Wuchereria, Loa, Mansonella, Trichinella, Trichuris, Ascaris, Anisakis, Dracunculus, Strongyloid.es, Haemonchus, Schistosoma and Fasciola. 21. the method according to any one of the preceding embodiments wherein two or more doses of the composition are administered to the subject. 22. The method according to embodiment 21 wherein the two doses are administered at least 1 week apart, about 2 weeks, about 3 weeks, about 4 weeks, about 6 weeks, about 8 weeks, about 10 weeks, about 12 weeks or about 16 weeks apart. 23. The method according to any one of the preceding embodiments wherein the subject is a vertebrate. 24. The method according to embodiment 23 wherein the subject is a mammal. 25. The method according to embodiment 24 wherein the subject is a human. 26. The method of embodiment 24 wherein the subject is a veterinary mammal. 27. The method according to embodiment 26 wherein the veterinary mammal is a cat, dog, horse, cow, sheep, deer, goat or pig. 28. The method of any one of the preceding embodiments wherein the composition further comprises a nucleic acid sequence that encodes an additional parasite antigen. 29. The method according to any one of the preceding embodiments wherein the composition further comprises an additional parasitic antigen. 30. The method of any of the preceding embodiments wherein the composition is administered to the subject in combination with another composition which comprises a nucleic acid comprising a sequence that encodes an additional parasite antigen. 31. The method of any of the preceding embodiments wherein the composition is administered to the subject in combination with another composition that comprises additional parasite antigen. A composition for use in a method for providing protective immunity against parasitic infection in a subject in need, which comprises an effective immunological amount of: (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen ; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. 33. The composition according to embodiment 32 for use in a method according to one of embodiments 1 to 31. 34. A composition comprising an effective immunological amount of: (i) a nucleic acid comprising a sequence which encodes a parasitic MIF antigen; or (ii) a parasitic MIF antigen; wherein the MIF antigen is from a protozoan parasite. 35. The composition according to embodiment 34, wherein the protozoan is an apicomplex parasite, such as Plasmodium. 36. The composition according to embodiment 34 or 35, wherein the protozoan belongs to a genus selected from the group, consisting of: Plasmodium, Toxoplasma, Babesia,
Eimeria, Theileria, Neospora, Sarcocystis, Leishmania and Trypanosoma. 37. A composition comprising an effective immunological amount of: (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; or (ii) a parasitic MIF antigen; wherein the MIF antigen is a parasitic helminth that belongs to a genus selected from the group consisting of: Ancyclostoma, Necator, Brugia, Wuchereria, Loa, Mansonella, Trichinella, Trichuris, Ascaris, Anisakis, Dracunculus, Strongyloides, Haemonchus, Schistosoma and Fasciola. 38. The composition of any one of embodiments 34 to 37, wherein the parasitic MIF antigen comprises a full-length MIF polypeptide or an immunogenic fragment thereof. 39. The composition according to one of embodiments 34 to 38 which comprises a nucleic acid vaccine comprising the nucleic acid sequence which encodes a parasitic MIF antigen. 40. The composition according to embodiment 39 wherein the nucleic acid vaccine is an RNA-based vaccine. 41. The composition of embodiment 40 wherein the nucleic acid vaccine comprises a self-replicating RNA molecule. 42. The composition of embodiment 41 wherein the autoreproducing RNA is an alphavirus-derived RNA replicon. 43. The composition according to one of embodiments 34 to 42, which comprises a cationic nanoemulsion delivery system (CNE). 44. The composition according to one of embodiments 34 to 42, which comprises a nanoparticle delivery system (LNP) of lipids. 45. The composition according to one of embodiments 34 to 44, which comprises one or more adjuvants. 46. The composition of any one of embodiments 34 to 45, wherein the composition further comprises a nucleic acid sequence that encodes an additional parasite antigen. 47. The composition of any one of embodiments 34 to 46 wherein the composition further comprises an additional parasitic antigen. 48. A method of ameliorating an immune response to a non-MIF parasite antigen in a subject, comprising administering an effective immunological amount of a composition to the subject, wherein the composition comprises: (i) an acid nucleic acid comprising a sequence that encodes a parasitic MIF antigen; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen. 49. The method of embodiment 48 which comprises administering the subject non-MIF parasite antigen. 50. The method according to embodiment 48 which is a method according to one of the embodiments 1-31. 51. A method for providing protective immunity against parasitic infection in a subject in need, comprising administering parasite-sensitive CD4 T cells isolated from a compatible host, wherein the host has been vaccinated with a composition comprising (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; or (ii) a parasitic MIF antigen. 52. The method according to embodiment 51 wherein the compatible host is administered a composition according to a method of one of embodiments 1-31.
权利要求:
Claims (18)
[1]
A composition for use in a method for providing protective immunity against parasitic infection in a subject in need, which comprises an effective immunological amount of one or more of: (i) a nucleic acid comprising a sequence which encodes a macrophage migration inhibition factor (MIF) antigen; (ii) a parasitic MIF antigen; or (iii) an antibody that specifically binds to a parasitic MIF antigen.
[2]
The composition for use according to claim 1 (i) wherein the composition comprises an RNA-based vaccine.
[3]
The composition for use according to claim 1 or 2 wherein the protective immunity is characterized by parasite-protective immune memory and / or an effective population of parasite-sensitive memory T cells.
[4]
The composition for use according to claim 1, 2 or 3 wherein the composition comprises a nucleic acid vaccine comprising the nucleic acid sequence which encodes a parasitic MIF antigen; for example, where the nucleic acid vaccine is an RNA-based vaccine, which may include a self-replicating RNA molecule, such as an alphavirus-derived RNA replicon.
[5]
The composition for use according to any one of the preceding claims wherein the composition comprises a cationic nanoemulsion delivery system (CNE) or a lipid nanoparticle delivery system (LNP).
[6]
The composition for use according to any one of the preceding claims, wherein the composition comprises one or more adjuvants.
[7]
The composition for use according to claim 1, wherein the antibody that specifically binds to a parasitic MIF antigen comprises a monoclonal antibody or a polyclonal antibody.
[8]
The composition for use according to claim 1, wherein the antibody that specifically binds to a parasitic MIF antigen is a human, humanized or chimeric monoclonal antibody.
[9]
The composition for use according to any one of the preceding claims wherein the parasite is a protozoan parasite, for example where (i) the protozoan is an apicomplexan parasite; and / or (ii) the protozoan belongs to a genus selected from the group consisting of: Plasmodium, Toxoplasma, Babesia, Eimeria, Theileria, Neospora, Sarcocystis, Leishmania, and Trypanosoma.
[10]
The composition for use according to any one of claims 1 to 8 wherein the parasite is a parasitic helminth, such as a nematode.
[11]
The composition for use according to claim 10, wherein the parasitic helminth belongs to a genus selected from the group consisting of: Ancyclostoma, Necator, Brugia, Wuchereria, Loa, Mansonella, Trichinella, Trichuris, Ascaris, Anisakis, Dracunculus , Strongyloides, Haemonchus, Schistosoma and Fasciola.
[12]
The composition for use according to any one of the preceding claims, wherein the subject is a vertebrate, such as a mammal, for example a human or veterinary mammal.
[13]
The composition for use according to any one of the preceding claims, wherein: (a) the composition further comprises a nucleic acid sequence that encodes an additional parasite antigen, and / or (b) the composition comprises in addition to additional parasite antigen, and / or (c) the composition is administered to the subject in combination with another composition which comprises a nucleic acid comprising a sequence which encodes an additional parasite antigen; and / or (d) the composition is administered to the subject in combination with another composition that comprises additional parasite antigen.
[14]
A composition comprising an effective immunological amount of: (i) a nucleic acid comprising a sequence that encodes a parasitic MIF antigen; or (ii) a parasitic MIF antigen; wherein the MIF antigen is from: (a) a protozoan parasite; or (b) a parasitic helminth that belongs to a genus selected from the group consisting of: Ancyclostoma, Necator, Brugia, Wuchereria, Loa, Mansonella, Trichinella, Trichuris, Ascaris, Anisakis, Dracunculus, Strongyloides, Haemonchus, Schistosoma and Fasciola.
[15]
The composition of claim 14 wherein the parasitic protozoan is an apicomplex parasite and / or belongs to a genus selected from the group consisting of: Plasmodium, Toxoplasma, Babesia, Eimeria, Theileria, Neospora, Sarcocystis, Leishmania and Trypanosoma.
[16]
The composition of any one of claims 14 to 15, wherein the parasitic MIF antigen is a full-length MIF polypeptide or an immunogenic fragment thereof.
[17]
The composition of any one of claims 14 to 16, which comprises a nucleic acid vaccine comprising the nucleic acid sequence that encodes a parasitic MIF antigen; for example, wherein the nucleic acid vaccine is an RNA-based vaccine, for example a self-replicating RNA molecule, which may be an alphavirus-derived RNA replicon.
[18]
18. The composition according to any of claims 14 to 17, which comprises a cationic nanoemulsion delivery system (CNE) or a nanoparticle delivery system (LNP) of lipids.
类似技术:
公开号 | 公开日 | 专利标题
US11007260B2|2021-05-18|Infectious disease vaccines
BE1024796B9|2019-01-08|ANTIGENIC CONSTRUCTS OF ZIKA VIRUS
BE1025121B1|2018-11-05|ANTIGENIC CONSTRUCTS OF ZIKA VIRUS
Xu et al.2009|A Schistosoma japonicum chimeric protein with a novel adjuvant induced a polarized Th1 immune response and protection against liver egg burdens
EP2678033B1|2019-05-01|Treatment and prevention of malaria
Romeih et al.2008|Immunization against Egyptian Schistosoma mansoni infection by multivalent DNA vaccine
US20210030859A1|2021-02-04|Uses of parasite macrophage migration inhibitory factors
US10300128B2|2019-05-28|Subunit vaccine platform based on multimeric ribonucleoproteins comprising nucleoproteins of a non-segmented negative-strand RNA virus as carriers of heterologous polypeptides
CA2466937A1|2003-05-30|Methylated heparin-binding hemagglutinin | recombinant mycobacterial antigen
Carneiro et al.2012|Vaccination with L. infantum chagasi nucleosomal histones confers protection against new world cutaneous leishmaniasis caused by Leishmania braziliensis
Le et al.2014|Simultaneous priming with DNA encoding Sm-p80 and boosting with Sm-p80 protein confers protection against challenge infection with Schistosoma mansoni in mice
FR3014103B1|2019-08-16|VACCINE COMPOSITION FOR THE PREVENTION AND / OR TREATMENT OF LEISHMANIOSES, IMMUNOGENIC PEPTIDES AND METHOD OF OBTAINING
EP3509630A1|2019-07-17|Thermostable variants of p. falciparum pfrh5 which can be produced in bacterial cells
BE1024785B1|2018-07-02|VACCINE
Zawawi2019|Towards the development of a novel vaccine for Trichuris trichiura
El Ridi et al.2015|The Schistosomiasis Vaccine–It is Time to Stand Up. Lausanne: Frontiers Media. doi: 10.3389
OA17769A|2017-11-30|A subunit vaccine platform based on multimeric ribonucleoproteins comprising nucleoproteins of a non-segmented negativestrand RNA virus as carriers of heterologous polypeptides
Cook2004|Immune attrition of adult Schistosoma mansoni worms and host immune mechanisms stimulated by DNA vaccination with SmCT-SOD, SmGPX, and Sm-filamin
Camus2012|Development and characterization of Lassa virus vaccines and mouse model
同族专利:
公开号 | 公开日
EP3122774A2|2017-02-01|
ES2844208T3|2021-07-21|
WO2015144732A2|2015-10-01|
US20210030859A1|2021-02-04|
WO2015144732A3|2015-12-03|
US20170106070A1|2017-04-20|
US10842859B2|2020-11-24|
EP3798229A1|2021-03-31|
BE1022446B1|2016-03-31|
BE1022446A1|2016-03-31|
EP3122774B1|2020-11-04|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题

US4458066A|1980-02-29|1984-07-03|University Patents, Inc.|Process for preparing polynucleotides|
US4500707A|1980-02-29|1985-02-19|University Patents, Inc.|Nucleosides useful in the preparation of polynucleotides|
US5132418A|1980-02-29|1992-07-21|University Patents, Inc.|Process for preparing polynucleotides|
US4973679A|1981-03-27|1990-11-27|University Patents, Inc.|Process for oligonucleo tide synthesis using phosphormidite intermediates|
US4668777A|1981-03-27|1987-05-26|University Patents, Inc.|Phosphoramidite nucleoside compounds|
US4373071A|1981-04-30|1983-02-08|City Of Hope Research Institute|Solid-phase synthesis of polynucleotides|
US5153319A|1986-03-31|1992-10-06|University Patents, Inc.|Process for preparing polynucleotides|
GB8819209D0|1988-08-12|1988-09-14|Research Corp Ltd|Polypeptide & dna encoding same|
US5262530A|1988-12-21|1993-11-16|Applied Biosystems, Inc.|Automated system for polynucleotide synthesis and purification|
US5047524A|1988-12-21|1991-09-10|Applied Biosystems, Inc.|Automated system for polynucleotide synthesis and purification|
US5928902A|1992-02-27|1999-07-27|Smithkline Beecham Biologicals |Hybrid protein between CS from plasmodium and HBsAg|
US5700642A|1995-05-22|1997-12-23|Sri International|Oligonucleotide sizing using immobilized cleavable primers|
US5707829A|1995-08-11|1998-01-13|Genetics Institute, Inc.|DNA sequences and secreted proteins encoded thereby|
US5681724A|1995-11-16|1997-10-28|Heska Corporation|Parasitic helminth macrophage inhibitory factor nucleic acid molecules and uses thereof|
DE19945114A1|1999-09-21|2001-03-22|Jagenberg Papiertech Gmbh|Device for cross-cutting material webs, in particular cardboard webs|
EP1221277B1|1999-10-15|2006-10-25|Phonak Ag|Binaural synchronisation|
WO2001078770A1|2000-04-14|2001-10-25|The Regents Of The University Of California|Inhibition of transmission of tick-borne infections|
WO2002070002A2|2001-03-07|2002-09-12|Universite De Lausanne|Methods for regulation of immune responses to conditions involving mediator-induced pathology|
AU2005245956B2|2004-05-18|2011-05-19|Alphavax, Inc.|TC-83-derived alphavirus vectors, particles and methods|
US20110300205A1|2009-07-06|2011-12-08|Novartis Ag|Self replicating rna molecules and uses thereof|
WO2011027222A2|2009-09-02|2011-03-10|Novartis Ag|Immunogenic compositions including tlr activity modulators|
US20130195968A1|2010-07-06|2013-08-01|Novartis Ag|Virion-like delivery particles for self-replicating rna molecules|
NZ606591A|2010-07-06|2015-02-27|Novartis Ag|Cationic oil-in-water emulsions|
MX341989B|2010-08-31|2016-09-09|Novartis Ag |Small liposomes for delivery of immunogen-encoding rna.|
EP2611420B1|2010-08-31|2019-03-27|GlaxoSmithKline Biologicals SA|Lipids suitable for liposomal delivery of protein-coding rna|
JP5911870B2|2010-08-31|2016-04-27|ノバルティス アーゲー|PEGylated liposomes for delivery of RNA encoding immunogens|
WO2013006834A1|2011-07-06|2013-01-10|Novartis Ag|Oil-in-water emulsions that contain nucleic acids|
MX350764B|2011-07-06|2017-09-18|Novartis Ag|Liposomes having useful n:p ratio for delivery of rna molecules.|
RU2649133C2|2011-07-06|2018-03-29|Новартис Аг|Cationic oil-in-water emulsions|
RU2628705C2|2011-08-31|2017-08-21|Новартис Аг|Pegylated liposomes for immunougen-coding rna delivery|RU2019123849A|2019-07-29|2021-02-01|Дзе Брихэм Энд Уимен`З Хоспитал, Инк.|INHIBITORS OF MACROPHAGES MIGRATION INHIBITION FACTOR|
法律状态:
优先权:
申请号 | 申请日 | 专利标题
EP14161614.4|2014-03-25|
EP14161614|2014-03-25|
[返回顶部]